CCDC79 antibodies are polyclonal rabbit-derived reagents designed to target the human CCDC79 protein, a meiosis-specific telomere-associated factor . These antibodies are primarily used in Western blot applications to investigate CCDC79's role in telomere dynamics during gametogenesis .
Meiosis-Specific Expression:
CCDC79 is expressed exclusively in male and female germ cells during meiosis. In mice, its transcription initiates at the onset of meiosis prophase I:
Telomeric Localization:
CCDC79 localizes to telomeres from leptotene to diplotene stages of prophase I. Immunofluorescence studies show co-localization with telomeric protein TRF1 and nuclear envelope protein SUN1 in pachytene spermatocytes (99.4% of telomeres) .
Domain Structure:
CCDC79 contains a C-terminal Myb domain, enabling potential direct binding to telomeric repeats .
| Parameter | Value |
|---|---|
| Host Species | Rabbit |
| Reactivities | Human |
| Applications | Western Blot (1.0 µg/mL) |
| Immunogen | Synthetic peptide (C-terminal sequence: ISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQ) |
| Molecular Weight | Predicted: 82 kDa |
| Storage | 4°C short-term; -20°C long-term |
Functional Studies:
Therapeutic Potential:
While CCDC79 itself is not a therapeutic target, its study informs mechanisms of meiotic fidelity, with broader implications for understanding aneuploidy and reproductive disorders .
CCDC79, also known as Telomere repeats-binding bouquet formation protein 1 (TERB1), is a meiosis-specific telomere-associated protein that plays a crucial role in meiotic telomere clustering, a process termed bouquet formation. This telomere-mediated chromosomal movement along the nuclear envelope is essential for homologous pairing and synapsis during meiosis. CCDC79 functions as a molecular hub for assembling a conserved meiotic telomere complex through interaction with TERF1. It promotes telomere association with the nuclear envelope, facilitates deposition of the SUN-KASH/LINC complex, and recruits cohesin to telomeres to develop structural rigidity necessary for proper chromosome dynamics during meiosis . Understanding CCDC79 provides significant insights into meiotic processes, chromosome behavior, and potential implications for reproductive biology research.
Current research on CCDC79 utilizes several antibody types, each with specific applications. Commercial options include rabbit polyclonal antibodies suitable for immunohistochemistry (IHC) and ELISA applications, as demonstrated by the EpigenTek CCDC79 Polyclonal Antibody that shows reactivity against human CCDC79 . For rat model systems, specialized ELISA kits are available with high sensitivity (detection limit of approximately 1.0 pg/mL) and a detection range of 10-2500 pg/mL . In published research, custom-generated antibodies raised against the C-terminal 103 amino acids of mouse CCDC79 have been successfully utilized for immunofluorescence studies on meiotic chromosome spreads . When selecting an antibody, researchers should consider species reactivity, application compatibility, and whether polyclonal or monoclonal properties better suit their experimental design.
CCDC79 exhibits a highly restricted expression pattern limited to meiotic germ cells in both males and females. In male mice, CCDC79 expression is undetectable in testes at 4 and 7 days post-partum (dpp) when germ cells have not yet entered meiosis. Expression becomes apparent at approximately 11 dpp, coinciding with meiotic initiation, and increases until 22 dpp, maintaining high levels in adult testis . In females, CCDC79 expression follows the timing of meiotic entry during embryonic development. No expression is detected in ovaries at 11.5 or 12.5 days post coitum (dpc), but strong expression appears at 14.5 dpc when most oocytes have entered meiotic prophase, gradually declining as oocytes progress to the dictyate stage . This restricted expression pattern makes CCDC79 an excellent marker for identifying meiotic cell populations and studying meiosis-specific processes.
For optimal immunohistochemical detection of CCDC79 in tissue sections, consider the following methodology:
Fixation: Use freshly prepared 4% paraformaldehyde for tissue fixation to preserve epitope integrity while maintaining morphology.
Antigen retrieval: Perform heat-induced epitope retrieval using citrate buffer (pH 6.0) for 20 minutes at 95°C to expose antibody binding sites that may be masked during fixation.
Blocking: Implement a robust blocking step (5% normal serum from the secondary antibody host species plus 0.3% Triton X-100) for 1 hour at room temperature to minimize background.
Antibody dilution: Begin testing with the recommended dilution range for IHC (1:20 - 1:200) as indicated for the EpigenTek CCDC79 Polyclonal Antibody, with 1:100 being reported as effective for human ovarian and prostate cancer tissues .
Incubation conditions: Incubate with primary antibody overnight at 4°C to maximize specific binding while minimizing background.
Controls: Include appropriate negative controls (omitting primary antibody) and positive controls (tissues with known CCDC79 expression, such as adult testis or embryonic ovaries at appropriate developmental stages).
Detection system: Select a detection system appropriate for your sample type, with horseradish peroxidase (HRP) systems being commonly used for archival tissues.
This methodological approach ensures specific signal detection while minimizing background interference.
For successful immunofluorescence detection of CCDC79 on meiotic chromosome spreads, follow this optimized protocol:
Spread preparation: Prepare nuclear surface spreads from fresh testicular or ovarian tissue following established methods that preserve chromosome structure (such as the drying-down technique).
Fixation: Fix spreads with 1% paraformaldehyde containing 0.15% Triton X-100 for 3 hours in a humid chamber.
Washing: Wash slides in 0.4% Photo-Flo 200 (Kodak) solution and air-dry.
Blocking: Block with 5% BSA, 0.2% Tween-20 in PBS for 1 hour at room temperature.
Primary antibody: For optimal results, dilute anti-CCDC79 antibody 1:200 in blocking solution and co-incubate with anti-SYCP3 antibody (1:500) as an axial element marker to facilitate stage identification of prophase cells.
Incubation: Incubate slides with primary antibodies overnight at 4°C in a humid chamber.
Secondary antibodies: After washing, apply appropriate fluorescently-labeled secondary antibodies and incubate for 1 hour at room temperature.
Counterstaining: Use DAPI (1 μg/ml) for DNA counterstaining.
This method has been validated in published research demonstrating that CCDC79 localizes to chromosome ends throughout meiotic prophase I and co-localizes with telomeric markers .
To ensure antibody specificity and validate experimental results, implement these critical validation approaches:
Negative controls: Test antibodies on tissues or cells known to lack CCDC79 expression. Somatic tissues or pre-meiotic germ cells (e.g., testis at 4-7 dpp) should show no specific signal .
Knockout/knockdown validation: The gold standard approach is testing antibodies on samples from CCDC79-deficient models or cells with CCDC79 knockdown. This has been demonstrated as an effective validation method in published research .
Blocking peptide competition: Pre-incubate the antibody with excess immunizing peptide (the C-terminal 103aa peptide for custom antibodies) before application to samples, which should abolish specific signals.
Multiple antibody concordance: Validate results using antibodies from different sources or raised against different epitopes of CCDC79. Published research confirms that antibodies obtained from sera of different animals showed similar immunostaining patterns .
Molecular weight verification: In Western blot applications, verify that the detected band matches the expected molecular weight of CCDC79.
Co-localization studies: Confirm that the antibody's staining pattern overlaps with known CCDC79 interactors or associated structures (such as telomeres using anti-TRF1 antibody).
Implementation of these validation strategies ensures experimental rigor and reproducibility in CCDC79 research.
CCDC79 antibodies provide valuable tools for investigating meiotic telomere dynamics through these advanced approaches:
Co-immunolocalization studies: Combine anti-CCDC79 with antibodies against other telomere-associated proteins (e.g., TRF1, SUN1) to analyze protein recruitment sequences and interdependencies at meiotic telomeres. Published research demonstrates the effective use of multiple-immunolabeling approaches to establish the relationship between CCDC79 and telomere attachment to the nuclear envelope .
Live-cell imaging: Correlate fixed-cell antibody studies with live-cell approaches using fluorescently tagged CCDC79 to analyze dynamic telomere movements. Information gained from antibody localization studies can guide the design of constructs for live imaging that maintain native localization patterns.
Super-resolution microscopy: Apply techniques such as structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) with CCDC79 antibodies to resolve the nanoscale organization of telomere attachment complexes beyond conventional microscopy limitations.
Sequential staging analysis: Use CCDC79 antibodies together with stage-specific markers of meiotic progression to create detailed temporal maps of telomere complex assembly and disassembly throughout meiosis.
Chromatin immunoprecipitation (ChIP): Optimize CCDC79 antibodies for ChIP applications to identify DNA sequences associated with CCDC79 and confirm its specific association with telomeric regions.
These approaches enable sophisticated analyses of the molecular mechanisms underlying telomere-led chromosome movements essential for meiotic progression.
Quantitative analysis of telomere clustering using CCDC79 antibodies can be achieved through these methodological approaches:
Cluster distribution analysis: Measure the spatial distribution of CCDC79 foci within the nuclear volume through 3D imaging and computational analysis. Calculate clustering indices such as nearest neighbor distances or Ripley's K-function to quantify the degree of bouquet formation.
Co-localization quantification: Measure the degree of overlap between CCDC79 signals and other telomere markers (TRF1) or nuclear envelope components (SUN1) using Pearson's correlation coefficient or Manders' overlap coefficient to assess attachment efficiency.
High-content screening approaches: Develop semi-automated image analysis pipelines that identify meiotic nuclei, detect CCDC79 foci, and measure their spatial distribution across large sample sizes to increase statistical power.
ELISA-based quantification: For samples where individual cell resolution is not required, utilize CCDC79 ELISA kits with sensitivity as low as 1.0 pg/mL and detection ranges of 10-2500 pg/mL to quantify total protein levels in tissue homogenates .
Comparative analysis in mutant models: Apply these quantitative measures to analyze telomere clustering defects in meiotic mutants (e.g., Sun1-/-, Smc1β-/-) compared to wild-type controls to establish mechanistic relationships.
These quantitative approaches transform descriptive observations into rigorous measurements that can detect subtle phenotypes and establish statistical significance in experimental comparisons.
When working with challenging tissue types or experimental conditions, researchers can implement these technical solutions:
Fixation optimization for preserved tissues:
For archival paraffin-embedded tissues, extend antigen retrieval times to 30 minutes and test multiple retrieval buffers (citrate pH 6.0, EDTA pH 8.0, Tris-EDTA pH 9.0).
For highly autofluorescent tissues, incorporate a Sudan Black B treatment step (0.1% in 70% ethanol) after secondary antibody incubation to reduce background fluorescence.
Signal amplification for low abundance detection:
Implement tyramide signal amplification (TSA) systems that can increase sensitivity 10-100 fold over conventional detection methods.
Consider using highly cross-adsorbed secondary antibodies specifically designed to minimize background in multiple labeling experiments.
Protocol adaptations for non-standard samples:
For cryopreserved tissues, extend antibody incubation times and optimize penetration with appropriate detergent concentrations.
For aged samples with potential epitope degradation, test antibodies recognizing different regions of CCDC79.
Advanced clearing techniques for whole-mount samples:
Integrate CCDC79 immunostaining with tissue clearing methods (CLARITY, iDISCO) for whole-mount analyses of telomere distribution in intact gonads.
Storage and handling considerations:
Implementation of these advanced approaches can significantly improve detection quality in technically challenging experimental systems.
This troubleshooting guide addresses the most common technical challenges while providing evidence-based solutions for researchers working with CCDC79 antibodies.
Accurate interpretation of CCDC79 immunostaining patterns requires understanding the characteristic localization changes across meiotic progression:
Leptotene stage: CCDC79 first appears as scattered foci on chromatin without association with forming axial elements. At this stage, the signal is typically weaker and requires careful exposure settings to detect without introducing background .
Early zygotene stage: As homologous chromosomes begin pairing, CCDC79 foci co-localize specifically with the ends of forming axial elements (identified by SYCP3 staining). This transition represents the initial formation of telomere attachments to the nuclear envelope .
Late zygotene to pachytene stages: CCDC79 appears as distinct foci at virtually all chromosome ends, with complete co-localization with telomeric markers like TRF1. This pattern reflects mature telomere attachment sites during bouquet formation. The signal intensity typically reaches maximum during pachytene .
Diplotene stage: CCDC79 remains associated with chromosome ends, but signal intensity may begin to decrease as the chromosome axis begins to disassemble .
Diakinesis/metaphase transition: CCDC79 signals weaken considerably and eventually disappear as cells progress beyond prophase I, making this protein an excellent marker for prophase I stages specifically .
When interpreting these patterns, always use co-staining with axis markers (SYCP3) to accurately determine the meiotic stage, as this significantly impacts the expected CCDC79 distribution and intensity.
To reliably distinguish between specific and non-specific signals in CCDC79 immunostaining, implement these critical analytical approaches:
Biological pattern validation: Legitimate CCDC79 signal should:
Titration analysis: Perform antibody titration series to identify concentrations where specific signal persists while background diminishes. True signals typically maintain relative intensity across a certain dilution range while non-specific background diminishes proportionally with dilution.
Multi-channel correlation analysis: In multi-color immunofluorescence, specific CCDC79 signals should show consistent spatial relationships with other components of the telomere complex across all observed cells.
Differential detergent sensitivity: Non-specific hydrophobic interactions often show greater sensitivity to increased detergent concentration compared to specific antibody-epitope binding. Test staining with increasing concentrations of Triton X-100 (0.1%-0.5%) to distinguish true signals.
Comparative analysis between tissues: Compare staining between tissues with known CCDC79 expression (adult testis) and tissues without expression (somatic tissues, pre-meiotic gonads) to establish signal specificity thresholds .
These analytical approaches, when systematically applied, significantly improve the reliability of CCDC79 immunostaining interpretation in research applications.
While CCDC79 research has primarily focused on basic meiotic mechanisms, several promising clinical research applications are emerging:
Biomarker potential in reproductive disorders: CCDC79 antibodies could be used to assess meiotic progression in testicular biopsies from infertility patients, potentially identifying cases where meiotic arrest involves telomere attachment defects. The availability of human-reactive antibodies makes this application technically feasible .
Cancer research applications: The observation that CCDC79 antibodies have been successfully used for immunohistochemistry in human ovarian and prostate cancer tissues suggests potential research applications in cancer biology . Telomere biology is increasingly recognized as important in cancer progression, and meiosis-specific proteins are sometimes aberrantly expressed in cancers.
Genetic disorder investigations: CCDC79 antibodies can be valuable tools for researching the cellular consequences of mutations affecting meiotic telomere functions in mouse models of human disorders, helping to establish genotype-phenotype relationships in hereditary conditions affecting reproduction.
Toxicology screening: Developing high-throughput screening approaches using CCDC79 antibodies could help identify environmental compounds that disrupt meiotic telomere functions, with potential applications in reproductive toxicology research.
These emerging applications demonstrate how foundational research tools can transition toward clinical research contexts while maintaining scientific rigor.
Cutting-edge methodological developments are expanding the research capabilities for CCDC79 investigation:
Proximity ligation assays (PLA): This technique can visualize and quantify protein interactions in situ with single-molecule sensitivity. Adapting PLA for CCDC79 and its binding partners (like TERF1) would provide spatial maps of protein complex formation during meiosis with unprecedented resolution.
CRISPR-based tagging of endogenous CCDC79: Genome editing approaches to tag endogenous CCDC79 with fluorescent proteins or epitope tags can complement antibody-based detection methods, allowing dynamic studies while maintaining physiological expression levels.
Single-cell proteomics integration: Combining antibody-based cell sorting of CCDC79-positive meiotic subpopulations with single-cell proteomics techniques could reveal stage-specific protein networks associated with telomere dynamics.
Expansion microscopy protocols: Adapting physical expansion of samples with CCDC79 immunofluorescence can provide super-resolution insights into telomere complex architecture without requiring specialized microscopy equipment.
Multiplex imaging approaches: Development of cyclic immunofluorescence or mass cytometry approaches incorporating CCDC79 antibodies would allow simultaneous detection of dozens of proteins in the telomere complex, providing systems-level understanding of meiotic telomere biology.
These methodological innovations represent the future direction of CCDC79 research, enabling increasingly sophisticated analyses of meiotic telomere function and regulation.
To gain comprehensive mechanistic insights, researchers should consider these integrated experimental strategies:
Combined ChIP-seq and immunofluorescence approaches: Integrate CCDC79 antibody-based chromatin immunoprecipitation with high-resolution microscopy to correlate genomic binding sites with spatial organization of telomeres during meiosis, providing both molecular and cellular perspectives.
Proteomics-guided immunoanalysis: Use IP-mass spectrometry to identify CCDC79 interaction partners, then validate and spatially map these interactions using co-immunofluorescence or proximity ligation assays in intact cells.
Functional genomics validation: Combine CRISPR-based manipulation of CCDC79 or its binding partners with antibody-based phenotypic analysis to establish causative relationships in telomere clustering mechanisms.
Temporal multi-omics integration: Correlate antibody-detected stages of CCDC79 localization with stage-specific transcriptomics and proteomics data to build comprehensive models of meiotic telomere complex assembly and function.
Cross-species comparative immunoanalysis: Use CCDC79 antibodies across evolutionary diverse model systems (when cross-reactivity permits) to identify conserved and divergent aspects of meiotic telomere functions through comparative studies.
These integrated approaches maximize the research value of CCDC79 antibodies by combining their spatial and temporal resolution advantages with the molecular insights provided by complementary techniques.