TGIF2LX Antibody

What is TGIF2LX and what is its biological significance?

TGIF2LX (TGFB-induced factor homeobox 2-like, X-linked) is a member of the TALE/TGIF homeobox family of transcription factors. The protein is specifically expressed in adult testis, suggesting a critical role in spermatogenesis . TGIF2LX is an X-linked gene, with a homolog located within the male-specific region of chromosome Y, believed to result from a large X-to-Y transposition. This genomic arrangement provides unique research opportunities for studying sex chromosome evolution and sex-specific gene expression patterns . The protein is predominantly localized in the nucleus, consistent with its suspected function as a transcription factor involved in testicular development and reproductive functions .

What are the molecular characteristics of TGIF2LX protein?

TGIF2LX is a protein with a calculated molecular weight of approximately 26-27 kDa, although it is commonly observed at around 34 kDa in SDS-PAGE analysis, suggesting potential post-translational modifications . The protein consists of 241 amino acids and contains a homeobox domain characteristic of transcription factors. The UniProt ID for human TGIF2LX is Q8IUE1. Analysis of its sequence reveals several phosphorylation sites, particularly at S19, S25, and T184, indicating potential regulation through phosphorylation pathways . The full amino acid sequence (as reported in databases) is:

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP

What types of TGIF2LX antibodies are available for research applications?

Multiple types of TGIF2LX antibodies are available for research applications, with varying specifications and validated uses:

Most commercially available antibodies are rabbit polyclonal immunoglobulins that have been affinity-purified using recombinant human TGIF2LX protein or peptide fragments as immunogens . These antibodies are generally stored in PBS with sodium azide and glycerol, with recommended storage at -20°C to maintain optimal functionality .

What are the optimal dilutions and applications for TGIF2LX antibody detection?

TGIF2LX antibodies have been validated for multiple applications, each with specific optimal dilution ranges:

It's important to note that optimal dilutions may vary depending on the specific antibody, sample type, and detection method. For Western blot applications, 1:500-1:1000 is commonly recommended , while specific dilutions for other applications should be determined empirically by the end user . For fluorescently-conjugated antibodies, such as Alexa Fluor 647-labeled TGIF2LX antibodies, protection from light during storage and use is essential to maintain signal integrity .

How should I optimize Western blot protocols for TGIF2LX detection?

For optimal Western blot detection of TGIF2LX, consider the following methodological approach:

• Sample preparation: Use human testis tissue as a positive control, as TGIF2LX is specifically expressed in adult testis . Include protease inhibitors in lysis buffers to prevent degradation.

• Protein loading: Load 20-40 μg of total protein per lane. TGIF2LX has relatively low abundance, so higher protein concentrations may be needed compared to housekeeping proteins.

• Gel percentage: Use 10-12% SDS-PAGE gels for optimal resolution around the expected 34 kDa molecular weight .

• Transfer conditions: Standard transfer protocols are generally effective; use PVDF membranes for highest protein retention.

• Blocking: Block with 5% non-fat milk or BSA in TBST for 1 hour at room temperature. Some antibodies may perform better with BSA than milk-based blockers.

• Primary antibody incubation: Dilute TGIF2LX antibody 1:500-1:1000 in blocking buffer and incubate overnight at 4°C .

• Washing steps: Perform 3-5 washes with TBST, 5-10 minutes each to reduce background.

• Detection system: Use HRP-conjugated secondary antibodies (anti-rabbit IgG for most TGIF2LX antibodies) and an appropriate ECL substrate system.

• Molecular weight expectations: Although the calculated molecular weight is 26-27 kDa, expect to observe a band at approximately 34 kDa due to post-translational modifications .

What considerations are important for immunohistochemical detection of TGIF2LX?

When performing immunohistochemistry (IHC) with TGIF2LX antibodies, several important considerations should be addressed:

• Tissue fixation: Standard fixation with 10% neutral buffered formalin preserves TGIF2LX epitopes while maintaining tissue morphology. Overfixation may mask epitopes and require more aggressive antigen retrieval.

• Antigen retrieval: Heat-mediated antigen retrieval in citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) is typically effective. Compare both methods to determine which provides optimal staining with your specific antibody.

• Blocking strategy: Thorough blocking is essential, as testicular tissue can show high background. Use 5-10% normal serum (from the species in which the secondary antibody was raised) plus 1% BSA to minimize non-specific binding.

• Antibody controls: Include positive controls (human testis) and negative controls (tissues known not to express TGIF2LX or primary antibody omission) in each experiment .

• Detection systems: For unconjugated primary antibodies, polymer-based detection systems often provide better signal-to-noise ratio than avidin-biotin systems, particularly in testicular tissue which may contain endogenous biotin.

• Expected staining pattern: TGIF2LX should show nuclear localization in testicular cells, particularly in spermatogenic cell lineages . Cytoplasmic staining may indicate background or non-specific binding.

• Counterstaining: Use mild hematoxylin counterstaining to avoid obscuring specific nuclear TGIF2LX signals.

What are common issues when using TGIF2LX antibodies and how can they be addressed?

Researchers commonly encounter several challenges when working with TGIF2LX antibodies:

• Multiple bands in Western blot:

  • Cause: Post-translational modifications (particularly phosphorylation at S19, S25, and T184), protein degradation, or splice variants

  • Solution: Include phosphatase inhibitors in sample preparation to preserve phosphorylation states, use fresh samples, and optimize sample preparation to minimize degradation

• Weak or absent signal:

  • Cause: Low expression levels of TGIF2LX (except in testis), suboptimal antibody concentration, or inadequate antigen retrieval

  • Solution: Use human testis as a positive control , optimize antibody concentration, extend incubation time, and test different antigen retrieval methods

• High background in IHC/ICC:

  • Cause: Insufficient blocking, high antibody concentration, or cross-reactivity

  • Solution: Extend blocking time to 1-2 hours, titrate antibody dilution, increase washing steps, and use highly purified antibody preparations

• Inconsistent results between experiments:

  • Cause: Antibody degradation, variation in sample preparation, or protocol inconsistencies

  • Solution: Aliquot antibodies to avoid freeze-thaw cycles, standardize sample collection and processing, and develop detailed protocols with precise timing

• Cross-reactivity with other proteins:

  • Cause: Homology between TGIF2LX and related proteins (especially TGIF2LY)

  • Solution: Use highly specific antibodies raised against unique regions of TGIF2LX, validate with knockdown controls, and perform peptide competition assays

How do post-translational modifications affect TGIF2LX antibody recognition?

Post-translational modifications (PTMs) significantly impact TGIF2LX antibody recognition and should be considered when designing experiments:

• Phosphorylation effects: TGIF2LX contains documented phosphorylation sites at S19, S25, and T184 . Phosphorylation can:

  • Alter epitope accessibility for antibody binding

  • Change protein migration in SDS-PAGE (contributing to the observed 34 kDa band versus calculated 26-27 kDa)

  • Affect protein-protein interactions and subcellular localization

• Experimental considerations:

  • Include phosphatase inhibitors in lysis buffers to maintain phosphorylation status

  • Consider using phospho-specific antibodies for studying activation states

  • Perform phosphatase treatment on parallel samples to determine if multiple bands are phosphorylation-dependent

  • Note the location of phosphorylation sites relative to the epitope recognized by your antibody

• Other potential PTMs: While phosphorylation sites are documented, other modifications like SUMOylation, ubiquitination, or acetylation may also occur and affect antibody binding or protein function .

• Influence on results interpretation: When comparing TGIF2LX expression across different samples or conditions, consider that changes in band intensity may reflect altered PTM status rather than total protein abundance.

What are the optimal storage conditions for maintaining TGIF2LX antibody functionality?

Proper storage of TGIF2LX antibodies is critical for maintaining their functionality over time:

When working with small antibody volumes (≤20 μL), some manufacturers incorporate 0.1% BSA as a carrier protein to enhance stability . Always refer to the manufacturer's specific recommendations, as storage conditions may vary based on antibody formulation, conjugation, and concentration.

How can TGIF2LX antibodies be used to study male reproductive biology?

TGIF2LX antibodies offer powerful tools for investigating male reproductive biology through several advanced applications:

• Spermatogenesis research:

  • Immunohistochemical profiling of TGIF2LX expression during different stages of spermatogenesis

  • Co-immunofluorescence with stage-specific markers to determine precise temporal expression patterns

  • Correlation of TGIF2LX localization with chromatin remodeling events during spermatogenesis

• Male infertility investigations:

  • Comparative analysis of TGIF2LX expression in testicular biopsies from fertile versus infertile men

  • Identification of altered expression or localization patterns associated with specific infertility phenotypes

  • Integration with genetic data to correlate TGIF2LX variations with functional consequences

• Transcriptional regulation studies:

  • ChIP-seq using TGIF2LX antibodies to identify genome-wide DNA binding sites in testicular cells

  • Analysis of TGIF2LX target genes relevant to spermatogenesis and male fertility

  • Investigation of TGIF2LX interaction with co-factors through co-immunoprecipitation followed by mass spectrometry

• Evolutionary biology:

  • Comparative analysis of TGIF2LX and its Y-chromosome homolog (TGIF2LY) using specific antibodies

  • Investigation of species differences in TGIF2LX expression and function

  • Study of sex chromosome evolution through TGIF2LX as a model X-linked gene

The testis-specific expression of TGIF2LX makes it a valuable marker and potential regulatory factor in male reproductive development and function, with antibody-based detection methods serving as crucial tools for these investigations.

What experimental approaches can elucidate TGIF2LX's role in transcriptional regulation?

As a member of the TALE/TGIF homeobox family of transcription factors , TGIF2LX likely plays important roles in gene regulation. Several experimental approaches using TGIF2LX antibodies can help elucidate these functions:

• Chromatin Immunoprecipitation (ChIP):

  • Use TGIF2LX antibodies to immunoprecipitate protein-DNA complexes

  • Combine with sequencing (ChIP-seq) to identify genome-wide binding sites

  • Perform ChIP-qPCR to validate binding to specific promoter regions

• Protein interaction studies:

  • Co-immunoprecipitation with TGIF2LX antibodies to identify interacting transcription factors and cofactors

  • Proximity labeling methods (BioID, APEX) to identify proteins in the vicinity of TGIF2LX

  • Pull-down assays with potential interacting proteins followed by Western blot with TGIF2LX antibodies

• Transcriptional reporter assays:

  • Construct reporter systems containing putative TGIF2LX binding sites

  • Combine with TGIF2LX overexpression or knockdown

  • Use antibodies to verify expression levels and correlate with reporter activity

• Dynamic nuclear localization:

  • Track TGIF2LX nuclear distribution using immunofluorescence under different cellular conditions

  • Examine co-localization with other transcription factors or chromatin markers

  • Investigate phosphorylation-dependent changes in nuclear localization

• Genome editing validation:

  • Create CRISPR/Cas9 knockouts or mutations of TGIF2LX

  • Validate editing efficiency using TGIF2LX antibodies

  • Examine consequences on downstream gene expression and cellular phenotypes

These approaches, when integrated, can provide comprehensive insights into TGIF2LX's role as a transcriptional regulator in testicular cells and potentially identify therapeutic targets for male reproductive disorders.

How can multi-omics approaches be integrated with TGIF2LX antibody studies?

Integration of TGIF2LX antibody-based methods with multi-omics approaches can provide comprehensive insights into its biological functions:

• Genomics + proteomics integration:

  • Correlate genetic variants in TGIF2LX with protein expression/localization detected by antibodies

  • Use CRISPR-edited cells with variant forms of TGIF2LX and antibody detection to analyze functional consequences

  • Perform proteome-wide analyses after TGIF2LX manipulation and validate key findings with antibodies

• Transcriptomics + ChIP-seq correlation:

  • Combine RNA-seq with TGIF2LX ChIP-seq (using specific antibodies) to identify direct transcriptional targets

  • Analyze gene expression changes after TGIF2LX knockdown/overexpression

  • Correlate binding strength (from ChIP-seq) with magnitude of expression changes

• Epigenomics integration:

  • Analyze histone modification patterns at TGIF2LX binding sites

  • Investigate relationships between DNA methylation and TGIF2LX occupancy

  • Examine chromatin accessibility changes in response to TGIF2LX manipulation

• Single-cell approaches:

  • Perform single-cell RNA-seq with antibody-based protein detection (CITE-seq)

  • Use spatial transcriptomics combined with TGIF2LX immunofluorescence to map expression in tissue context

  • Identify cell populations with differential TGIF2LX activity in complex testicular tissue

• Phosphoproteomics:

  • Map TGIF2LX phosphorylation sites and their dynamics under different conditions

  • Identify kinases and phosphatases regulating TGIF2LX activity

  • Develop phospho-specific antibodies for studying activation states

These integrated approaches provide a systems-level understanding of TGIF2LX function in testicular biology and potentially reveal new insights into male reproductive health and disease mechanisms.

What are the critical considerations when selecting TGIF2LX antibodies for specific research applications?

When selecting TGIF2LX antibodies for specific research applications, consider these critical factors:

• Epitope specificity:

  • Determine whether the antibody targets a unique region of TGIF2LX or a conserved domain

  • For distinguishing between TGIF2LX and its Y-chromosome homolog, select antibodies raised against divergent regions

  • Review the immunogen sequence information provided by manufacturers

• Validated applications:

  • Check if the antibody has been validated for your specific application (WB, IHC, ChIP, etc.)

  • Review validation data provided by the manufacturer, including positive controls

  • Consider the detection method (fluorescence vs. chromogenic) compatible with your experimental setup

• Species reactivity:

  • Verify cross-reactivity with your species of interest (human, mouse, rat)

  • For evolutionary studies, select antibodies that work across multiple species

  • Consider sequence homology between species in the epitope region

• Technical specifications:

  • Review recommended dilutions for your application

  • Check antibody format (unconjugated vs. directly conjugated)

  • Consider antibody isotype and host species for compatibility with your detection systems

• Post-translational modification sensitivity:

  • Determine if the antibody's epitope contains known PTM sites (S19, S25, T184)

  • For phosphorylation studies, consider phospho-specific antibodies if available

  • Test recognition of modified vs. unmodified forms if studying PTM-dependent functions

• Reproducibility factors:

  • Review literature citations for independent validation

  • Consider clone stability for monoclonal antibodies or lot-to-lot consistency for polyclonals

  • Check for unique identifiers like RRID (Research Resource Identifier) for tracking

By carefully evaluating these factors, researchers can select TGIF2LX antibodies optimally suited for their specific experimental requirements and research questions.

What potential roles does TGIF2LX play in cellular pathways beyond reproduction?

While TGIF2LX is predominantly expressed in testis , emerging research suggests potential roles beyond reproduction that could be investigated using antibody-based approaches:

• TGF-β signaling modulation:

  • As suggested by its name (TGFB-induced factor), TGIF2LX may interact with TGF-β pathway components

  • Antibodies can be used to examine co-localization or co-immunoprecipitation with SMAD proteins

  • Investigate whether TGIF2LX serves as a repressor or activator in this pathway through chromatin modification studies

• Potential roles in cancer biology:

  • Examine TGIF2LX expression in testicular cancers versus normal tissue

  • Investigate correlation between TGIF2LX levels and tumor progression or treatment response

  • Study effects of TGIF2LX manipulation on cancer cell proliferation, migration, and invasion

• Developmental regulation:

  • Examine potential transient expression during embryonic development

  • Investigate evolutionary conservation of function across species

  • Study potential roles in stem cell maintenance or differentiation

• Cellular stress responses:

  • Examine TGIF2LX expression and localization changes under various stress conditions

  • Investigate potential roles in DNA damage response or apoptotic pathways

  • Study phosphorylation dynamics in response to cellular stressors

• Chromosome X inactivation escape:

  • As an X-linked gene, investigate whether TGIF2LX escapes X-inactivation in females

  • Compare expression levels between males and females in appropriate tissues

  • Study potential sex-specific functions beyond reproductive biology

While these potential roles remain largely unexplored, antibody-based detection methods will be essential tools for investigating TGIF2LX functions in diverse cellular contexts beyond its well-established role in testicular biology.