THAP6 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction

The THAP6 antibody is a research-grade reagent designed to detect and study the THAP6 protein, a member of the THAP domain-containing family of DNA-binding transcription factors. These proteins regulate gene expression by interacting with specific DNA sequences and coactivators. The antibody is widely used in molecular biology for applications such as Western blotting, immunohistochemistry (IHC), and immunofluorescence (IF) to analyze THAP6 expression in human tissues and cell lines.

Structure and Function of THAP6

THAP6 is a 222-amino-acid protein encoded by the THAP6 gene located on human chromosome 4q21.1 . It contains a THAP-type zinc finger domain, enabling sequence-specific DNA binding, and exists as two alternatively spliced isoforms . Functional studies suggest THAP6 may play roles in transcriptional regulation, though its precise biological role remains under investigation .

Production and Characteristics of THAP6 Antibodies

THAP6 antibodies are primarily polyclonal rabbit IgG antibodies raised against recombinant protein fragments. Key features include:

  • Immunogen: Recombinant proteins corresponding to amino acids 1–222 or specific epitopes (e.g., LKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS) .

  • Applications: Validated for Western blot (0.04–0.4 µg/mL), IHC (1:50–1:200), IF (0.25–2 µg/mL), and ELISA .

  • Reactivity: Human-specific, with no reported cross-reactivity with other THAP family members .

Research Applications and Findings

The THAP6 antibody has been employed to study protein localization and expression in:

  • Human tissues: Moderate cytoplasmic positivity in respiratory epithelial cells (nasopharynx) and nuclear staining in A-431 cell line .

  • Pathological contexts: Limited data, but THAP6’s chromosomal location (4q21.1) overlaps with regions linked to Huntington’s disease and FGFR3-related disorders .

  • Functional studies: No direct association with diseases has been reported, though THAP family proteins (e.g., THAP1, THAP12) are implicated in transcriptional regulation and cancer progression .

Validation and Quality Control

Antibodies are validated through:

  • Western blot: Detects overexpressed THAP6 in HEK293T lysates .

  • Immunohistochemistry: Tested on tissue arrays (44 normal, 20 cancer types) .

  • Protein array: Cross-reactivity assessed against 364 human proteins .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (12-14 weeks)
Synonyms
THAP6 antibody; THAP domain-containing protein 6 antibody
Target Names
THAP6
Uniprot No.

Q&A

What is THAP6 protein and why is it studied?

THAP6 (THAP domain-containing protein 6) is a 222 amino acid protein that contains one THAP-type zinc finger and exists as two alternatively spliced isoforms. The gene encoding THAP6 consists of approximately 36,528 bases and maps to human chromosome 4q21.1. Chromosome 4 represents approximately 6% of the human genome and contains nearly 900 genes . THAP6 belongs to the THAP family of proteins which are characterized by their DNA-binding domains. Current research suggests THAP proteins may play roles in cell proliferation and gene regulation, making them important targets for study in various cellular processes .

What types of THAP6 antibodies are commercially available?

Based on current research resources, there are several types of THAP6 antibodies available:

Antibody TypeHostClonalityApplicationsReactivitySuppliers
Anti-THAP6RabbitPolyclonalIHCHumanAntibodies.com
THAP6 AntibodyRabbitPolyclonalELISA, IHCHumanAbbexa
THAP6 MonoclonalMouseMonoclonal (OTI1F6)IHC-P, WBHumanOriGene
THAP6 AntibodyRabbitPolyclonalWB, IHC, ICC/IFHumanNovus Biologicals
THAP6 AntibodyRabbitPolyclonalIB, IF, IHCHumanSigma-Aldrich
Anti-THAP6 RecombinantMouseMultiple clonesWB, IH, IFHumanCreative Biolabs

What are the recommended storage conditions for THAP6 antibodies?

Most THAP6 antibodies require careful storage to maintain their activity. The consensus storage recommendations across multiple manufacturers are:

  • Store at -20°C for long-term storage

  • For short-term use (up to 2 weeks), store at 2-8°C

  • Avoid repeated freeze/thaw cycles as this can damage antibody structure and function

  • Most are supplied in buffer containing glycerol (typically 40-50%) and sodium azide (0.02-0.05%) as preservatives

What applications are THAP6 antibodies validated for?

THAP6 antibodies have been validated for several research applications:

ApplicationRecommended DilutionsNotes
Immunohistochemistry (IHC)1:25-1:200Paraffin-embedded tissues, tested on human esophagus cancer tissue
Western Blot (WB)0.04-0.4 μg/mLDetects endogenous levels of total THAP6 protein
ELISA1:2000-1:5000For quantitative detection
Immunofluorescence (IF)0.25-2 μg/mLFor subcellular localization studies
Immunocytochemistry (ICC)1-4 μg/mLFor cellular studies

How do I determine the optimal antibody concentration for my THAP6 experiment?

For optimal results with THAP6 antibodies, a titration experiment is essential:

  • Begin with the manufacturer's recommended dilution range (e.g., 1:50-1:200 for IHC)

  • Perform a titration series (typically 3-5 dilutions within and beyond the recommended range)

  • Include appropriate positive controls (human tissues known to express THAP6)

  • Include negative controls:

    • Primary antibody omission control

    • Isotype control (matching IgG at the same concentration)

  • Evaluate signal-to-noise ratio for each dilution

  • Select the dilution that provides optimal specific signal with minimal background

This approach allows researchers to account for variations in experimental conditions, sample types, and detection methods that might affect optimal antibody concentration.

What positive controls should I use for THAP6 antibody validation?

Based on available validation data for THAP6 antibodies:

  • Tissue samples:

    • Human esophagus cancer tissue has been successfully used for IHC validation

    • Human tissues from chromosome 4q21.1 region expression profiles may also serve as positive controls

  • Cell lysates:

    • Cell lines with confirmed THAP6 expression (through qPCR or other methods)

    • Recombinant THAP6 protein as a standard for Western blot

  • Expression systems:

    • Overexpression lysates from cells transfected with full-length THAP6 constructs

    • E. coli-produced recombinant human THAP6 protein

The ideal validation would include orthogonal methods (e.g., RNA expression data, genetic knockdown) to confirm specificity.

How can I reduce background staining in THAP6 immunohistochemistry?

When optimizing IHC protocols for THAP6 detection:

  • Blocking optimization:

    • Use 5-10% serum from the same species as the secondary antibody

    • Consider adding 0.1-0.3% Triton X-100 for better penetration

    • Include protein blockers (1-5% BSA or casein)

  • Antibody incubation conditions:

    • Extend primary antibody incubation time (overnight at 4°C)

    • Increase washing steps (5x 5 minutes with gentle agitation)

    • Dilute antibody in blocking buffer with 0.05-0.1% Tween-20

  • Antigen retrieval optimization:

    • Compare heat-induced epitope retrieval methods (citrate pH 6.0 vs. EDTA pH 9.0)

    • Adjust retrieval time and temperature

  • Detection system considerations:

    • Use polymer-based detection systems for better signal-to-noise ratio

    • Consider biotinylated secondary antibodies with streptavidin-HRP if endogenous biotin is blocked

  • Additional controls:

    • Perform peptide competition assays using the immunogen sequence to confirm specificity

How can I use THAP6 antibodies in ChIP experiments?

While specific ChIP protocols for THAP6 are not widely documented, based on protocols used for the related THAP family member THAP1 :

  • Protocol adaptation:

    • Use 5 μg of THAP6-specific antibody per ChIP reaction

    • Crosslink with 1% formaldehyde for 10 minutes at room temperature

    • Sonicate chromatin to 200-500 bp fragments

    • Perform immunoprecipitation overnight at 4°C

  • Controls and validation:

    • Include IgG control from the same species as the THAP6 antibody

    • Validate antibody specificity for chromatin-bound THAP6 by Western blot

    • Use qPCR to analyze potential THAP6 binding sites

    • Include known targets of related THAP proteins as reference points

  • Sequential ChIP considerations:

    • For studying THAP6 co-occupancy with other factors, sequential ChIP may be necessary

    • Based on THAP1 studies, consider investigating co-occupancy with HCF-1 and OGT

What are the key considerations for using THAP6 antibodies in multiplexed immunofluorescence?

For successful multiplexed detection including THAP6:

  • Antibody compatibility planning:

    • Select THAP6 antibodies from different host species than other target antibodies

    • If using same-species antibodies, direct labeling or sequential immunostaining is required

    • Verify that secondary antibodies have minimal cross-reactivity

  • Signal separation strategy:

    • Use fluorophores with minimal spectral overlap

    • Consider THAP6 expression level when selecting fluorophore brightness

    • Validate single-staining controls before multiplexing

  • Technical considerations:

    • Apply appropriate blocking between sequential applications

    • Optimize antibody concentration for each target individually before multiplexing

    • Consider tyramide signal amplification for low-abundance targets

    • Include appropriate controls for autofluorescence and bleed-through

  • Analysis approaches:

    • Use multispectral imaging for better signal separation

    • Apply spectral unmixing algorithms for overlapping fluorophores

    • Quantify colocalization using appropriate statistical methods

How can computational approaches improve THAP6 antibody specificity analysis?

Advanced computational methods can enhance THAP6 antibody characterization :

  • Epitope mapping and binding prediction:

    • In silico analysis of the THAP6 immunogen sequence to identify potential cross-reactive proteins

    • Structural modeling of antibody-antigen interactions using available protein structure data

    • Prediction of antibody binding modes using machine learning algorithms

  • High-throughput sequencing applications:

    • Combine phage display experiments with next-generation sequencing to identify optimal THAP6 binders

    • Apply computational models to disentangle various binding modes for closely related epitopes

    • Design antibodies with customized specificity profiles through energy function optimization

  • Cross-reactivity analysis:

    • Utilize protein databases to identify proteins with sequence similarity to THAP6

    • Apply protein array data to systematically test cross-reactivity

    • Use machine learning algorithms to predict potential off-target binding

How do I verify THAP6 antibody specificity in my experimental system?

To ensure specificity for THAP6:

  • Genetic validation approaches:

    • CRISPR/Cas9-mediated THAP6 knockout as negative control

    • siRNA-mediated THAP6 knockdown to verify signal reduction

    • Overexpression systems to verify signal increase

  • Biochemical validation:

    • Peptide competition assay using the immunogen sequence

    • Western blot analysis to confirm band at expected molecular weight (approximately 25 kDa)

    • Immunoprecipitation followed by mass spectrometry to identify pulled-down proteins

  • Orthogonal method correlation:

    • Compare protein detection with mRNA expression (RT-PCR, RNA-seq)

    • Use multiple antibodies targeting different THAP6 epitopes

    • Follow antibody validation guidelines from the International Working Group for Antibody Validation

What are common issues in THAP6 Western blot experiments and how can they be addressed?

When troubleshooting Western blots for THAP6:

  • No signal issues:

    • Verify THAP6 expression in your sample (RNA level checks)

    • Test antibody on recombinant THAP6 protein as positive control

    • Adjust antibody concentration (try higher concentrations)

    • Optimize protein extraction methods (consider nuclear extraction protocols)

    • Extend exposure time for detection

  • Multiple bands:

    • Compare band pattern with known THAP6 isoforms (two alternatively spliced variants)

    • Perform phosphatase treatment to check for post-translational modifications

    • Run peptide competition assay to identify specific bands

    • Consider tissue-specific expression patterns of isoforms

  • Optimization strategies:

    • Adjust blocking conditions (try 5% BSA instead of milk for phospho-specific detection)

    • Optimize transfer conditions for small proteins like THAP6

    • Increase washing stringency to reduce background

    • Consider using gradient gels for better separation

How can I register and properly cite THAP6 antibodies in my research?

Proper antibody citation is crucial for research reproducibility :

  • Registration process:

    • Look up the THAP6 antibody in the Antibody Registry (https://antibodyregistry.org)

    • If not found, you can register the antibody to obtain a Research Resource Identifier (RRID)

    • Include complete information: vendor, catalog number, lot number, clone name, etc.

  • Citation format in publications:

    • Include RRID in materials and methods section: "Anti-THAP6 antibody (Vendor, Cat#, RRID:AB_XXXXXXX)"

    • Provide complete experimental details: dilution, incubation time, detection method

    • Include validation performed specifically for your experimental system

  • Additional best practices:

    • Document lot numbers as antibody performance can vary between lots

    • Store validation data in open repositories when possible

    • Share detailed protocols via protocol repositories or supplementary materials

The Antibody Registry has significantly improved antibody identification in literature, with uniquely identifiable antibody references (catalog numbers or RRIDs) increasing from 12% in 1997 to 31% in 2020 .

How can I assess the developability of custom THAP6 antibodies?

For researchers developing novel THAP6 antibodies, developability assessment is crucial :

  • Early-stage screening parameters:

    • Expression level and yield in the chosen production system

    • Thermal stability (Tm by differential scanning fluorimetry)

    • Aggregation propensity (size-exclusion chromatography, dynamic light scattering)

    • Post-translational modification (PTM) hotspots

    • pH-dependent solubility profiles

  • In silico analysis for sequence optimization:

    • Identify and remove high-risk motifs (NG/NS/DG motifs, extra Cys residues)

    • Check for N-glycosylation motifs in variable regions

    • Analyze surface hydrophobicity and charge distribution

    • Predict potential aggregation-prone regions

  • Experimental assessment workflow:

    • Screen different buffer formulations for optimal stability

    • Perform forced degradation studies (thermal stress, pH stress)

    • Evaluate non-specific binding to unrelated proteins

    • Assess stability under storage conditions

What techniques can be used to study THAP6 protein interactions using antibodies?

To investigate THAP6 protein-protein interactions:

  • Co-immunoprecipitation (Co-IP) approaches:

    • Use anti-THAP6 antibodies for pull-down experiments

    • Based on studies of THAP1, consider investigating potential interactions with HCF-1 and OGT

    • Include appropriate controls (IgG control, reverse IP)

    • Validate interacting partners by Western blot or mass spectrometry

  • Proximity labeling methods:

    • BioID or TurboID fusion with THAP6 to identify proximal proteins

    • APEX2 fusion for electron microscopy visualization

    • Combine with THAP6 antibodies for validation

  • Advanced microscopy techniques:

    • Proximity ligation assay (PLA) using THAP6 antibody paired with antibodies against potential interactors

    • FRET or FLIM-FRET analysis using fluorescently-labeled antibodies

    • Super-resolution microscopy for co-localization studies

How can I apply next-generation sequencing approaches to THAP6 antibody research?

Integration of NGS with THAP6 antibody applications:

  • Single-cell applications:

    • CITE-seq (Cellular Indexing of Transcriptomes and Epitopes by Sequencing) combining THAP6 antibodies with transcriptomics

    • Ab-seq for paired heavy and light chain sequencing of THAP6-specific antibodies

    • Spatial transcriptomics combined with THAP6 immunohistochemistry

  • Repertoire analysis approaches:

    • Deep immunoglobulin repertoire sequencing to identify THAP6-binding antibody clonotypes

    • Analysis of somatic hypermutation patterns in anti-THAP6 antibodies

    • Computational identification of shared binding motifs

  • Functional genomics integration:

    • CUT&Tag using THAP6 antibodies to map genome-wide binding sites

    • ChIP-seq to identify THAP6 genomic targets

    • Integration with ATAC-seq and RNA-seq for comprehensive regulatory network analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.