The THAP6 antibody is a research-grade reagent designed to detect and study the THAP6 protein, a member of the THAP domain-containing family of DNA-binding transcription factors. These proteins regulate gene expression by interacting with specific DNA sequences and coactivators. The antibody is widely used in molecular biology for applications such as Western blotting, immunohistochemistry (IHC), and immunofluorescence (IF) to analyze THAP6 expression in human tissues and cell lines.
THAP6 is a 222-amino-acid protein encoded by the THAP6 gene located on human chromosome 4q21.1 . It contains a THAP-type zinc finger domain, enabling sequence-specific DNA binding, and exists as two alternatively spliced isoforms . Functional studies suggest THAP6 may play roles in transcriptional regulation, though its precise biological role remains under investigation .
THAP6 antibodies are primarily polyclonal rabbit IgG antibodies raised against recombinant protein fragments. Key features include:
Immunogen: Recombinant proteins corresponding to amino acids 1–222 or specific epitopes (e.g., LKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS) .
Applications: Validated for Western blot (0.04–0.4 µg/mL), IHC (1:50–1:200), IF (0.25–2 µg/mL), and ELISA .
Reactivity: Human-specific, with no reported cross-reactivity with other THAP family members .
The THAP6 antibody has been employed to study protein localization and expression in:
Human tissues: Moderate cytoplasmic positivity in respiratory epithelial cells (nasopharynx) and nuclear staining in A-431 cell line .
Pathological contexts: Limited data, but THAP6’s chromosomal location (4q21.1) overlaps with regions linked to Huntington’s disease and FGFR3-related disorders .
Functional studies: No direct association with diseases has been reported, though THAP family proteins (e.g., THAP1, THAP12) are implicated in transcriptional regulation and cancer progression .
Antibodies are validated through:
THAP6 (THAP domain-containing protein 6) is a 222 amino acid protein that contains one THAP-type zinc finger and exists as two alternatively spliced isoforms. The gene encoding THAP6 consists of approximately 36,528 bases and maps to human chromosome 4q21.1. Chromosome 4 represents approximately 6% of the human genome and contains nearly 900 genes . THAP6 belongs to the THAP family of proteins which are characterized by their DNA-binding domains. Current research suggests THAP proteins may play roles in cell proliferation and gene regulation, making them important targets for study in various cellular processes .
Based on current research resources, there are several types of THAP6 antibodies available:
Most THAP6 antibodies require careful storage to maintain their activity. The consensus storage recommendations across multiple manufacturers are:
Avoid repeated freeze/thaw cycles as this can damage antibody structure and function
Most are supplied in buffer containing glycerol (typically 40-50%) and sodium azide (0.02-0.05%) as preservatives
THAP6 antibodies have been validated for several research applications:
For optimal results with THAP6 antibodies, a titration experiment is essential:
Begin with the manufacturer's recommended dilution range (e.g., 1:50-1:200 for IHC)
Perform a titration series (typically 3-5 dilutions within and beyond the recommended range)
Include appropriate positive controls (human tissues known to express THAP6)
Include negative controls:
Primary antibody omission control
Isotype control (matching IgG at the same concentration)
Evaluate signal-to-noise ratio for each dilution
Select the dilution that provides optimal specific signal with minimal background
This approach allows researchers to account for variations in experimental conditions, sample types, and detection methods that might affect optimal antibody concentration.
Based on available validation data for THAP6 antibodies:
Tissue samples:
Cell lysates:
Cell lines with confirmed THAP6 expression (through qPCR or other methods)
Recombinant THAP6 protein as a standard for Western blot
Expression systems:
The ideal validation would include orthogonal methods (e.g., RNA expression data, genetic knockdown) to confirm specificity.
When optimizing IHC protocols for THAP6 detection:
Blocking optimization:
Use 5-10% serum from the same species as the secondary antibody
Consider adding 0.1-0.3% Triton X-100 for better penetration
Include protein blockers (1-5% BSA or casein)
Antibody incubation conditions:
Extend primary antibody incubation time (overnight at 4°C)
Increase washing steps (5x 5 minutes with gentle agitation)
Dilute antibody in blocking buffer with 0.05-0.1% Tween-20
Antigen retrieval optimization:
Compare heat-induced epitope retrieval methods (citrate pH 6.0 vs. EDTA pH 9.0)
Adjust retrieval time and temperature
Detection system considerations:
Use polymer-based detection systems for better signal-to-noise ratio
Consider biotinylated secondary antibodies with streptavidin-HRP if endogenous biotin is blocked
Additional controls:
While specific ChIP protocols for THAP6 are not widely documented, based on protocols used for the related THAP family member THAP1 :
Protocol adaptation:
Use 5 μg of THAP6-specific antibody per ChIP reaction
Crosslink with 1% formaldehyde for 10 minutes at room temperature
Sonicate chromatin to 200-500 bp fragments
Perform immunoprecipitation overnight at 4°C
Controls and validation:
Include IgG control from the same species as the THAP6 antibody
Validate antibody specificity for chromatin-bound THAP6 by Western blot
Use qPCR to analyze potential THAP6 binding sites
Include known targets of related THAP proteins as reference points
Sequential ChIP considerations:
For successful multiplexed detection including THAP6:
Antibody compatibility planning:
Select THAP6 antibodies from different host species than other target antibodies
If using same-species antibodies, direct labeling or sequential immunostaining is required
Verify that secondary antibodies have minimal cross-reactivity
Signal separation strategy:
Use fluorophores with minimal spectral overlap
Consider THAP6 expression level when selecting fluorophore brightness
Validate single-staining controls before multiplexing
Technical considerations:
Apply appropriate blocking between sequential applications
Optimize antibody concentration for each target individually before multiplexing
Consider tyramide signal amplification for low-abundance targets
Include appropriate controls for autofluorescence and bleed-through
Analysis approaches:
Use multispectral imaging for better signal separation
Apply spectral unmixing algorithms for overlapping fluorophores
Quantify colocalization using appropriate statistical methods
Advanced computational methods can enhance THAP6 antibody characterization :
Epitope mapping and binding prediction:
In silico analysis of the THAP6 immunogen sequence to identify potential cross-reactive proteins
Structural modeling of antibody-antigen interactions using available protein structure data
Prediction of antibody binding modes using machine learning algorithms
High-throughput sequencing applications:
Cross-reactivity analysis:
Utilize protein databases to identify proteins with sequence similarity to THAP6
Apply protein array data to systematically test cross-reactivity
Use machine learning algorithms to predict potential off-target binding
To ensure specificity for THAP6:
Genetic validation approaches:
CRISPR/Cas9-mediated THAP6 knockout as negative control
siRNA-mediated THAP6 knockdown to verify signal reduction
Overexpression systems to verify signal increase
Biochemical validation:
Orthogonal method correlation:
Compare protein detection with mRNA expression (RT-PCR, RNA-seq)
Use multiple antibodies targeting different THAP6 epitopes
Follow antibody validation guidelines from the International Working Group for Antibody Validation
When troubleshooting Western blots for THAP6:
No signal issues:
Verify THAP6 expression in your sample (RNA level checks)
Test antibody on recombinant THAP6 protein as positive control
Adjust antibody concentration (try higher concentrations)
Optimize protein extraction methods (consider nuclear extraction protocols)
Extend exposure time for detection
Multiple bands:
Optimization strategies:
Adjust blocking conditions (try 5% BSA instead of milk for phospho-specific detection)
Optimize transfer conditions for small proteins like THAP6
Increase washing stringency to reduce background
Consider using gradient gels for better separation
Proper antibody citation is crucial for research reproducibility :
Registration process:
Look up the THAP6 antibody in the Antibody Registry (https://antibodyregistry.org)
If not found, you can register the antibody to obtain a Research Resource Identifier (RRID)
Include complete information: vendor, catalog number, lot number, clone name, etc.
Citation format in publications:
Include RRID in materials and methods section: "Anti-THAP6 antibody (Vendor, Cat#, RRID:AB_XXXXXXX)"
Provide complete experimental details: dilution, incubation time, detection method
Include validation performed specifically for your experimental system
Additional best practices:
Document lot numbers as antibody performance can vary between lots
Store validation data in open repositories when possible
Share detailed protocols via protocol repositories or supplementary materials
The Antibody Registry has significantly improved antibody identification in literature, with uniquely identifiable antibody references (catalog numbers or RRIDs) increasing from 12% in 1997 to 31% in 2020 .
For researchers developing novel THAP6 antibodies, developability assessment is crucial :
Early-stage screening parameters:
Expression level and yield in the chosen production system
Thermal stability (Tm by differential scanning fluorimetry)
Aggregation propensity (size-exclusion chromatography, dynamic light scattering)
Post-translational modification (PTM) hotspots
pH-dependent solubility profiles
In silico analysis for sequence optimization:
Identify and remove high-risk motifs (NG/NS/DG motifs, extra Cys residues)
Check for N-glycosylation motifs in variable regions
Analyze surface hydrophobicity and charge distribution
Predict potential aggregation-prone regions
Experimental assessment workflow:
Screen different buffer formulations for optimal stability
Perform forced degradation studies (thermal stress, pH stress)
Evaluate non-specific binding to unrelated proteins
Assess stability under storage conditions
To investigate THAP6 protein-protein interactions:
Co-immunoprecipitation (Co-IP) approaches:
Proximity labeling methods:
BioID or TurboID fusion with THAP6 to identify proximal proteins
APEX2 fusion for electron microscopy visualization
Combine with THAP6 antibodies for validation
Advanced microscopy techniques:
Proximity ligation assay (PLA) using THAP6 antibody paired with antibodies against potential interactors
FRET or FLIM-FRET analysis using fluorescently-labeled antibodies
Super-resolution microscopy for co-localization studies
Integration of NGS with THAP6 antibody applications:
Single-cell applications:
CITE-seq (Cellular Indexing of Transcriptomes and Epitopes by Sequencing) combining THAP6 antibodies with transcriptomics
Ab-seq for paired heavy and light chain sequencing of THAP6-specific antibodies
Spatial transcriptomics combined with THAP6 immunohistochemistry
Repertoire analysis approaches:
Functional genomics integration:
CUT&Tag using THAP6 antibodies to map genome-wide binding sites
ChIP-seq to identify THAP6 genomic targets
Integration with ATAC-seq and RNA-seq for comprehensive regulatory network analysis