trabd2b Antibody

What is TRABD2B and what is its biological function?

TRABD2B (also known as TIKI2, HKAT) is a 517 amino acid metalloproteinase that functions as a negative regulator of the Wnt signaling pathway. It mediates the cleavage of 8 N-terminal residues of certain Wnt proteins, causing them to become oxidized and form large disulfide-bond oligomers that lead to their inactivation. TRABD2B specifically cleaves WNT3A and WNT5, but not WNT11 . This protein is required for head formation during development and has been implicated in cancer biology, showing upregulation in renal cell carcinoma while appearing to suppress growth of osteosarcoma by targeting the canonical Wnt pathway .

Tiki metalloproteins are dependent on Mn2+/Co2+ and are inhibited by divalent metal chelators like EDTA. Unlike its paralog TIKI1 (TRABD2A), which lacks known metalloprotease motifs, TRABD2B contains recognizable metalloprotease domains .

What are the common synonyms and alternative designations for TRABD2B?

TRABD2B is referred to by several names in the scientific literature and antibody catalogs:

These multiple designations reflect the protein's various functional and structural characteristics as understood through evolving research .

What applications are TRABD2B antibodies validated for in research settings?

TRABD2B antibodies have been validated for multiple research applications, though specific capabilities vary by antibody clone and manufacturer:

When selecting an antibody for a specific application, researchers should review manufacturer validation data for the specific clone of interest, as performance can vary significantly .

How does TRABD2B function as an immune checkpoint and what experimental considerations does this entail?

Recent research has identified TRABD2B as a potential immune checkpoint molecule. Patent information suggests that TRABD2B expression on CD8+ T cell membranes may inhibit their cytotoxic function against target cells . Experimental evidence indicates that when TRABD2B is inhibited, CD8+ T cells demonstrate enhanced killing effects against target cells.

For researchers studying immune checkpoints:

• Consider establishing monocyte-induced dendritic cell and killer CD8+ T cell culture systems to verify TRABD2B expression on T cell surfaces

• When designing experiments to evaluate TRABD2B as an immune checkpoint target, include appropriate controls to distinguish its effects from other checkpoint molecules

• Anti-TRABD2B monoclonal antibodies may serve as immune checkpoint inhibitors that improve CD8+ T cell killing of tumor cells

• Consider experimental designs that compare TRABD2B, TRABD2A, or combined inhibition to determine optimal targeting strategies

What are the technical challenges in detecting TRABD2B protein in experimental systems?

Detecting TRABD2B presents several technical challenges that researchers should consider:

• Protein Size Variation: TRABD2B has a calculated molecular weight of 57 kDa but is typically observed at 65-79 kDa in Western blots, likely due to post-translational modifications . Researchers should account for this size discrepancy when interpreting results.

• Antibody Selection: Different antibodies recognize distinct epitopes of TRABD2B. For example, the antibody ABIN7159479 targets amino acids 195-405, while HPA045817 targets a different sequence (QVLFALNQTLLQQESVRAGSLQASYTTEDLIKHYNCGDLSAVIFNHDTSQLPNFINTTLPPHEQVTAQEIDSYFRQELIY) . This may affect detection depending on protein conformation or processing.

• Expression Levels: TRABD2B may have tissue-specific expression patterns, with enrichment in heart, kidney, and adipose tissues as suggested by its alternative name . Low expression levels in certain tissues may necessitate optimized detection methods.

• Antibody Validation: When studying TRABD2B in novel contexts, validation with appropriate positive controls (such as transfected cell lines overexpressing TRABD2B) is strongly recommended .

What are the optimal protocols for using TRABD2B antibodies in Western blotting applications?

For optimal Western blotting with TRABD2B antibodies, consider the following protocol recommendations:

• Sample Preparation:

  • Use appropriate lysis buffers that preserve metalloproteases (avoid excessive EDTA which inhibits Tiki metalloproteases)

  • Include protease inhibitors to prevent degradation

• Gel Electrophoresis and Transfer:

  • Use reducing conditions as demonstrated in validation studies

  • Expected molecular weight range: 65-79 kDa (versus calculated 57 kDa)

• Antibody Dilution and Incubation:

  • Primary antibody dilution: 1:500-1:1000 (for product 28682-1-AP)

  • For other antibodies, follow manufacturer-specific recommendations

  • Positive control recommendation: HEK293 cells transfected with human TRABD2B

• Detection and Troubleshooting:

  • Validated cell lines for positive detection include DU 145, HT-29, and HeLa cells

  • If non-specific bands appear, additional blocking optimization may be required

  • For challenging samples, consider immunoprecipitation prior to Western blotting

How are TRABD2B antibodies being utilized in cancer research?

TRABD2B antibodies are valuable tools in cancer research due to the protein's differential expression and functional roles in various cancer types:

• Renal Cell Carcinoma: TRABD2B is upregulated in renal cell carcinoma, suggesting potential diagnostic or therapeutic applications. Antibodies can help assess expression levels across tumor samples and correlate with clinical outcomes .

• Osteosarcoma: TRABD2B appears to suppress osteosarcoma growth by targeting the canonical Wnt pathway. Researchers can use antibodies to study the mechanism of this suppression and explore therapeutic potential .

• Immunotherapy Applications: The identification of TRABD2B as an immune checkpoint molecule opens new avenues for cancer immunotherapy research. Anti-TRABD2B monoclonal antibodies may enhance CD8+ T cell-mediated killing of tumor cells, similar to established checkpoint inhibitors .

For cancer research applications, immunohistochemistry protocols typically recommend dilutions of 1:20-1:50 for optimal staining results . When designing cancer-focused experiments, consider including panels of cell lines with varying TRABD2B expression levels to establish correlations with malignant phenotypes.

What considerations are important when using TRABD2B antibodies to study Wnt signaling pathways?

When studying Wnt signaling using TRABD2B antibodies, researchers should consider:

• Functional Specificity: TRABD2B specifically cleaves WNT3A and WNT5, but not WNT11 . Experimental designs should account for this selectivity when studying particular Wnt pathway branches.

• Pathway Cross-talk: Since TRABD2B negatively regulates Wnt signaling, its inhibition or overexpression may have indirect effects on other signaling pathways that interact with Wnt.

• Context-Dependent Function: The effect of TRABD2B on Wnt signaling may vary between developmental contexts and disease states. Use appropriate model systems that recapitulate the biological context of interest.

• Experimental Controls: When studying TRABD2B's effect on Wnt signaling, include:

  • Positive controls for Wnt pathway activation (e.g., WNT3A stimulation)

  • Readouts for pathway activity (β-catenin localization, TOP/FOP reporter assays)

  • Comparisons with established Wnt pathway inhibitors

• Technical Approach: Consider using multiple antibodies targeting different epitopes of TRABD2B to validate findings and rule out non-specific effects.

What are the optimal storage and handling conditions for TRABD2B antibodies?

Proper storage and handling are critical for maintaining antibody functionality. For TRABD2B antibodies:

Some manufacturers note that their TRABD2B antibodies contain hazardous substances (e.g., Proclin 300) that should be handled by trained staff only . Always refer to the specific manufacturer's recommendations, as formulations may vary.

How can researchers validate the specificity of TRABD2B antibodies in their experimental systems?

Validating antibody specificity is crucial for reliable research outcomes. For TRABD2B antibodies, consider these validation approaches:

• Positive Controls:

  • Use cell lines with known TRABD2B expression (DU 145, HT-29, HeLa cells)

  • Compare with TRABD2B-transfected cells versus mock-transfected controls

• Negative Controls:

  • Use TRABD2B knockout or knockdown systems

  • Include isotype control antibodies to assess non-specific binding

• Peptide Competition Assays:

  • Pre-incubate antibody with immunizing peptide to confirm binding specificity

  • If the signal disappears with peptide competition, this supports antibody specificity

• Multiple Detection Methods:

  • Compare results across different applications (WB, IHC, IF)

  • Use multiple antibodies targeting different epitopes

• Mass Spectrometry Validation:

  • For ultimate confirmation, immunoprecipitate with TRABD2B antibody and confirm protein identity by mass spectrometry

Documented validation is particularly important for TRABD2B given its various synonyms and potential confusion with related proteins like TRABD2A or TRABD .

What are the key considerations for performing immunofluorescence studies with TRABD2B antibodies?

When conducting immunofluorescence experiments with TRABD2B antibodies:

• Fixation and Permeabilization:

  • Optimize fixation method (paraformaldehyde, methanol, or acetone) as this can affect epitope accessibility

  • Ensure adequate permeabilization if targeting intracellular domains

• Antibody Selection:

  • For direct detection, consider FITC-conjugated TRABD2B antibodies

  • For greater sensitivity, use unconjugated primary antibodies with fluorophore-conjugated secondary antibodies

• Controls and Counterstaining:

  • Include appropriate negative controls (secondary antibody only, isotype control)

  • Use nuclear counterstains (DAPI, Hoechst) for cellular context

  • Consider co-staining with organelle markers to determine subcellular localization

• Image Acquisition and Analysis:

  • Use appropriate filter sets matching the fluorophore

  • Capture images at multiple focal planes to ensure complete visualization

  • Quantify signal intensity using appropriate software for comparative analyses

• Troubleshooting:

  • If background is high, optimize blocking conditions and antibody dilutions

  • If signal is weak, consider signal amplification methods or longer exposure times

  • For autofluorescent tissues, use specific quenching methods or spectral unmixing

Remember that optimal protocols may need to be empirically determined for each experimental system and antibody combination.