TJAP1 Antibody

What is TJAP1 and what functional significance does it have in experimental systems?

TJAP1 (Tight Junction Associated Protein 1, Peripheral), also known as PILT, TJP4 (Tight Junction Protein 4), is a protein that colocalizes at tight junctions. It functions as a bridge in cellular junction complexes and plays roles in cellular compartmentalization.

The protein exists in several forms:

• Native form: approximately 60 kDa

• Modified form: 86-95 kDa (as observed in Western blot applications)

For experimental validation of TJAP1-related pathways, researchers should consider its interaction with other tight junction complex proteins and its potential roles in barrier function regulation.

What specific applications are validated for commercial TJAP1 antibodies?

Based on technical validation data across multiple manufacturers, TJAP1 antibodies have been successfully applied in:

When designing experiments, researchers should select antibodies specifically validated for their intended application rather than assuming cross-application effectiveness .

How should TJAP1 antibodies be stored and handled to maintain optimal reactivity?

Proper handling of TJAP1 antibodies is critical for experimental reproducibility. Based on manufacturer recommendations:

• Store antibodies at -20°C for long-term storage

• Avoid repeated freeze/thaw cycles by aliquoting upon receipt

• Most commercial TJAP1 antibodies are supplied in PBS buffer with 50% glycerol and preservatives (0.02% sodium azide, 0.05% Proclin 300)

• Antibody stability: Most are stable for one year after shipment when properly stored

For working solutions, prepare fresh dilutions and use within 24-48 hours for optimal signal-to-noise ratio in experimental applications.

What controls should be included when using TJAP1 antibodies in experimental designs?

Effective experimental design requires appropriate controls when using TJAP1 antibodies:

Positive controls:

• Human skeletal muscle tissue and HepG2 cells show detectable TJAP1 expression

• Recombinant TJAP1 proteins can serve as positive controls in Western blot applications

Negative controls:

• Knockout cell lines and isogenic parental controls provide the most stringent validation

• Secondary antibody-only controls to assess non-specific binding

• Isotype controls (e.g., Rabbit IgG for rabbit polyclonal TJAP1 antibodies)

When publishing results, documentation of these controls is essential for result interpretation and reproducibility.

How can researchers systematically validate the specificity of commercial TJAP1 antibodies?

Comprehensive antibody validation requires multiple approaches as demonstrated in the YCharOS initiative:

• Knockout validation:

  • Compare antibody signals between TJAP1 knockout cell lines and isogenic parental controls

  • This approach provides definitive evidence of specificity

• Cross-platform validation:

  • Test antibody performance across multiple applications (WB, IP, IF)

  • Different applications may reveal different specificity profiles for the same antibody

• Epitope analysis:

  • Analyze the immunogen sequence to predict potential cross-reactivity

  • Different commercial antibodies target distinct epitopes:

    • HPA030164: amino acids corresponding to GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP

    • HPA030166: amino acids corresponding to RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS

    • A308283: amino acids 356-557 of human TJAP1 (NP_001139488)

• Recombinant expression:

  • Express tagged TJAP1 to verify antibody recognition

  • Use titrated expression levels to assess sensitivity thresholds

What methodological considerations exist for optimizing TJAP1 immunoprecipitation experiments?

Successful immunoprecipitation of TJAP1 requires careful experimental design:

• Antibody selection:

  • Choose antibodies specifically validated for IP applications

  • Consider using a combination of antibodies targeting different epitopes to increase capture efficiency

• Lysis conditions:

  • TJAP1 is a tight junction-associated protein, requiring careful membrane solubilization

  • Test different detergents (NP-40, Triton X-100, CHAPS) at varying concentrations to optimize solubilization while preserving protein-protein interactions

• Cross-linking considerations:

  • For transient interactions, consider membrane-permeable crosslinkers to stabilize complexes

  • DSP (dithiobis[succinimidyl propionate]) has been effective for junction protein complex preservation

• Elution strategies:

  • For mass spectrometry applications, consider native elution with competing peptides

  • For Western blot verification, standard SDS elution is typically sufficient

• Co-IP verification:

  • Always verify pulled-down TJAP1 by Western blot alongside any co-immunoprecipitated partners

  • Use size-exclusion chromatography to verify complex formation independently

How can researchers address data inconsistencies when working with TJAP1 antibodies in different experimental systems?

When facing inconsistent results with TJAP1 antibodies across experimental systems:

• Molecular weight variability analysis:

  • TJAP1 shows variable molecular weights due to post-translational modifications

  • Native form: approximately 60 kDa

  • Modified forms: 86-95 kDa

  • Document exact molecular weights observed in your system to track modifications

• Cell line-specific expression patterns:

  • The YCharOS initiative demonstrated that antibody performance varies across cell lines

  • Cell-specific TJAP1 variants or post-translational modifications may affect epitope accessibility

• Application-specific optimization:

  • Different buffer systems may be required for different applications

  • For Western blot: Optimize transfer conditions for high-molecular-weight forms

  • For IF/ICC: Test different fixation methods (PFA vs. methanol) as they affect epitope exposure differently

• Quantitative analysis:

  • Use quantitative approaches like quantitative Western blot or flow cytometry

  • Compare relative vs. absolute quantification methods

  • Consider normalizing to total protein rather than housekeeping genes when analyzing TJAP1 levels

How should researchers interpret TJAP1 localization patterns in immunofluorescence studies?

Proper interpretation of TJAP1 immunofluorescence patterns requires careful consideration:

What methodological approaches exist for studying TJAP1 in disease models and clinical samples?

When investigating TJAP1 in disease contexts:

• Tissue microarray analysis:

  • Commercial TJAP1 antibodies have been validated on tissue microarrays containing normal and cancer tissues

  • The Human Protein Atlas provides baseline expression data across 44 normal human tissues

• Quantitative expression analysis:

  • qPCR for transcript levels should complement protein-level investigations

  • Consider targeted proteomics approaches for absolute quantification

  • Digital pathology algorithms can quantify expression patterns in tissue sections

• Genetic manipulation models:

  • CRISPR-engineered cell lines with TJAP1 knockout provide powerful models

  • Tagged TJAP1 variants can track protein dynamics in disease models

  • Consider conditional knockouts for developmental studies where complete loss may be lethal

• Clinical sample considerations:

  • Fixation variables significantly impact antibody performance

  • For FFPE tissues, antigen retrieval optimization is crucial

  • Fresh frozen tissues may better preserve certain epitopes

  • Consider multiplex staining to assess TJAP1 in context of other junction markers

What technical approaches can characterize TJAP1 protein-protein interactions in research contexts?

For comprehensive analysis of TJAP1 protein interactions:

• Biophysical interaction characterization:

  • Surface Plasmon Resonance (SPR) has been successfully used to measure binding kinetics of antibodies to target proteins

  • BIAcore T200 platforms enable quantitative measurement of binding affinities (KD values)

• Protein complex isolation strategies:

  • Tandem affinity purification with tagged TJAP1

  • BioID or APEX proximity labeling to identify neighboring proteins

  • Size exclusion chromatography can separate intact complexes for downstream analysis

• Structural analysis approaches:

  • Protein docking models can predict interaction surfaces

  • In silico analysis has been used to model antibody-antigen interactions

  • Cryo-EM may be suitable for larger junction complexes containing TJAP1

• Functional validation:

  • Peptide competition assays to disrupt specific interactions

  • Mutational analysis of predicted interaction domains

  • FRET/BRET assays for dynamic interaction analysis in living cells

These methodologies provide complementary approaches to dissect the TJAP1 interactome in different cellular contexts.