TMCO6 Antibody

What is TMCO6 protein and where is it expressed?

TMCO6 (Transmembrane and coiled-coil domains 6) is a multi-pass membrane protein with a calculated molecular weight of approximately 54 kDa (observed at 50-54 kDa in experimental conditions) . The protein is encoded by the TMCO6 gene (Gene ID: 55374) . Expression analysis demonstrates that TMCO6 can be detected in various human tissues, with notable presence in testis, spleen, and lung tissues . In mouse models, TMCO6 expression has been observed in brain tissue . The protein's membrane localization and coiled-coil domains suggest potential roles in cellular signaling or structural organization, though specific functions require further characterization .

Most commercially available TMCO6 antibodies demonstrate reactivity with:

When working with non-human models, it's essential to confirm the species cross-reactivity of your chosen antibody before proceeding with experiments .

What are the recommended protocols for Western blot analysis using TMCO6 antibodies?

For Western blot applications, TMCO6 antibodies require specific dilution ranges and sample preparation techniques for optimal results:

• Sample Preparation: TMCO6 can be detected in tissue lysates from human testis and mouse brain . Protein extraction should be performed using standard lysis buffers containing protease inhibitors.

• Antibody Dilution: The recommended dilution ranges vary by manufacturer:

  • 1:1000-1:4000

  • 1:500-1:2000

• Detection: The expected molecular weight band should appear at 50-54 kDa .

• Controls: Human testis tissue and mouse brain tissue lysates serve as effective positive controls .

• Optimization: It's advisable to perform an initial titration experiment to determine the optimal antibody concentration for your specific sample type .

How should TMCO6 antibodies be used in immunohistochemistry applications?

For IHC applications, consider the following methodological recommendations:

• Tissue Selection: Human spleen and lung tissues have shown positive staining for TMCO6 .

• Antigen Retrieval: Suggested antigen retrieval with TE buffer pH 9.0; alternatively, citrate buffer pH 6.0 may be used .

• Antibody Dilution: Recommended dilution ranges:

  • 1:20-1:200

  • 1:50-1:200

• Detection System: Standard ABC or polymer-based detection systems are compatible.

• Visualization: DAB (3,3'-diaminobenzidine) is commonly used as the chromogen.

What are the optimal storage conditions for maintaining TMCO6 antibody activity?

Proper storage is critical for maintaining antibody functionality:

• Temperature: Store at -20°C .

• Formulation: Most TMCO6 antibodies are supplied in PBS with 0.02% sodium azide and 50% glycerol at pH 7.3 .

• Aliquoting: For long-term storage, aliquoting is recommended to avoid repeated freeze-thaw cycles .

• Stability: When properly stored, antibodies typically remain stable for 12 months from the date of receipt .

• Working Solutions: Diluted working solutions should be prepared fresh before use and are not recommended for long-term storage.

How can researchers validate the specificity of TMCO6 antibodies?

Validating antibody specificity is crucial for ensuring experimental reliability:

• Positive Controls: Use tissues with known TMCO6 expression such as human testis, spleen, or lung tissues .

• Western Blot Validation: Confirm the presence of a specific band at the expected molecular weight (50-54 kDa) .

• Immunogen Comparison: Review the immunogen sequence used to generate the antibody. For instance, HPA037473 was generated using the sequence "EREAALRKARREQQLVSKRLLRNDAPEEAGEGCVAAILGETEVQQFLRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRL..." .

• Knockout/Knockdown Controls: When possible, use TMCO6 knockout or knockdown samples as negative controls to confirm specificity.

• Cross-Validation: Compare results using multiple antibodies targeting different epitopes of TMCO6.

What is known about TMCO6 expression in cancer research?

The Human Protein Atlas provides valuable resources for understanding TMCO6 expression in cancer contexts:

• Cancer Tissue Profiling: Antibody staining data is available for 20 different cancer types, offering insights into differential expression patterns .

• Patient Survival Correlation: The Human Protein Atlas includes correlation analysis between TMCO6 mRNA expression and patient survival for various cancer types .

• Cancer Cell Line Expression: RNA expression data from cancer cell lines can provide additional information about TMCO6 expression in vitro models .

• Methodological Approach: For cancer expression studies, researchers should consider using a combination of IHC (protein level) and RNA analysis to comprehensively characterize TMCO6 expression .

What considerations are important when performing co-immunoprecipitation with TMCO6 antibodies?

When designing co-IP experiments to study TMCO6 protein interactions:

• Antibody Selection: Choose antibodies that have been validated for immunoprecipitation or that target epitopes unlikely to be involved in protein-protein interactions.

• Membrane Protein Considerations: As TMCO6 is a multi-pass membrane protein , specialized lysis conditions may be required to maintain protein solubility while preserving native protein-protein interactions.

• Cross-Linking: Consider using membrane-permeable cross-linking agents to stabilize transient interactions before cell lysis.

• Controls: Include appropriate negative controls (non-specific IgG) and positive controls (input lysate) in all experiments.

• Validation: Confirm successful immunoprecipitation of TMCO6 by Western blot analysis using a different antibody targeting a separate epitope.

How can researchers address non-specific binding issues with TMCO6 antibodies?

Non-specific binding can compromise experimental results. Consider these approaches to improve specificity:

• Blocking Optimization: Extend blocking time or try alternative blocking agents (BSA, normal serum, commercial blocking solutions).

• Antibody Dilution: Test a range of antibody dilutions. For TMCO6 antibodies, start with the recommended dilutions (WB: 1:1000-1:4000, IHC: 1:20-1:200) .

• Incubation Conditions: Optimize temperature and duration of primary antibody incubation.

• Washing Protocol: Increase the number or duration of washing steps to reduce background signal.

• Secondary Antibody Selection: Ensure your secondary antibody is appropriate for your primary antibody species and isotype (typically rabbit IgG for TMCO6 antibodies) .

What factors affect the choice between different commercial TMCO6 antibodies?

Several factors should guide your selection of TMCO6 antibodies:

• Application Validation: Choose antibodies validated for your specific application (WB, IHC, ELISA) .

• Species Reactivity: Confirm reactivity with your experimental model organism .

• Immunogen: Consider the immunogen used to generate the antibody. For example, some TMCO6 antibodies use full fusion proteins while others use synthesized peptides .

• Clonality: All available TMCO6 antibodies in the search results are polyclonal, which may provide broader epitope recognition but potentially more batch-to-batch variation .

• Supporting Data: Review available validation data, including Western blot images and IHC staining patterns provided by manufacturers.

How might TMCO6 be studied in relation to other membrane proteins?

As a transmembrane protein, TMCO6 may participate in important membrane-associated complexes:

• Proximity Labeling: Consider BioID or APEX2-based proximity labeling approaches to identify proteins in close spatial proximity to TMCO6.

• Membrane Proteomics: Employ specialized membrane protein extraction protocols followed by mass spectrometry to identify TMCO6-associated protein complexes.

• Subcellular Localization: Use co-localization studies with markers for different membrane compartments to precisely define TMCO6 localization .

• Structure-Function Analysis: Investigate the role of TMCO6's coiled-coil domains in mediating protein-protein interactions.

• Cross-Linking Mass Spectrometry: Apply chemical cross-linking followed by mass spectrometry to capture and identify TMCO6 interaction partners.

What considerations are important when designing knockout/knockdown experiments for TMCO6?

When planning genetic manipulation of TMCO6:

• Knockdown Validation: Confirm TMCO6 knockdown efficiency at both mRNA and protein levels, using the antibodies discussed above for protein detection .

• Knockout Strategy: Consider the multi-exon structure of TMCO6 when designing CRISPR-Cas9 knockout strategies to ensure complete loss of function.

• Functional Assays: Based on TMCO6's membrane localization , consider membrane trafficking, signaling, or structural integrity assays to assess functional consequences of TMCO6 depletion.

• Rescue Experiments: Design rescue experiments with wild-type and mutant TMCO6 constructs to confirm specificity of observed phenotypes.

• Tissue-Specific Effects: Given TMCO6's differential expression across tissues , consider tissue-specific knockout approaches for in vivo studies.