TSK Antibody

What is TSK protein and why is it significant in research?

TSK (Tsukushi) is a secreted protein encoded by the TSKU gene, functioning as a small leucine-rich proteoglycan. The human version has a canonical amino acid length of 353 residues and a protein mass of 37.8 kilodaltons. It is widely expressed in many tissue types and serves important biological roles in eye development, cholesterol metabolism and homeostasis . Also known as E2IG4 and LRRC54, TSK is an extracellular coordinator of multiple signaling networks, particularly in inhibiting BMP and Wnt signaling pathways . Its research significance stems from its involvement in critical biological processes including wound healing, ectodermal patterning, neural crest specification, and thermogenesis regulation .

What types of TSK antibodies are available for research applications?

Currently, several types of TSK antibodies are available for research:

• Polyclonal antibodies: Most commonly available, these are primarily produced in rabbits against specific TSK epitopes.

• Species-reactive antibodies: Antibodies that recognize TSK in various species, including human, mouse, and rat samples .

• Application-specific antibodies: Validated for specific techniques such as Western Blot, ELISA, Immunocytochemistry, Immunohistochemistry, and Immunofluorescence .

Most TSK antibodies are available in unconjugated form, with working dilutions ranging from 0.04-0.4 μg/mL for Western blotting and 1:50-1:200 for immunohistochemistry applications .

How should I optimize TSK antibody dilutions for Western blot applications?

For Western blot optimization with TSK antibodies:

• Initial titration: Begin with the manufacturer's recommended range (typically 0.04-0.4 μg/mL for most commercial TSK antibodies) .

• Optimization protocol:

  • Prepare a dilution series (e.g., 0.02, 0.1, 0.2, 0.4, 0.8 μg/mL)

  • Use consistent protein loading (20-30 μg of total protein)

  • Include positive controls (tissues with known TSK expression: colon tissue samples work well based on immunohistochemistry data)

  • Include negative controls (tissues or cell lines with minimal TSK expression or TSK knockout samples if available)

• Signal-to-noise assessment: The optimal dilution provides clear specific bands at the expected molecular weight (~38 kDa) with minimal background.

• Validation approach: If possible, confirm specificity using knockdown samples, as several commercial TSK antibodies are validated using this approach .

Remember that TSK is a secreted protein, so appropriate sample preparation techniques ensuring capture of extracellular proteins may be necessary.

What are the recommended procedures for immunohistochemical detection of TSK in tissue samples?

For optimal immunohistochemical detection of TSK:

• Tissue preparation:

  • Fixation: 10% neutral buffered formalin (24-48 hours)

  • Paraffin embedding following standard protocols

  • Section thickness: 4-6 μm sections recommended

• Antigen retrieval:

  • Heat-induced epitope retrieval using basic antigen retrieval reagent is recommended

  • Boil sections in retrieval buffer for 15-20 minutes, followed by 20-minute cooling

• Antibody protocol:

  • Blocking: 5-10% normal serum (matching secondary antibody host) for 1 hour

  • Primary antibody: Apply TSK antibody at 1:50-1:200 dilution (or 5-20 μg/mL)

  • Incubation: Overnight at 4°C for optimal results

  • Detection: HRP-DAB staining system appropriate for the primary antibody host

• Controls and validation:

  • Positive control: Human colon cancer tissue shows specific staining in smooth muscle

  • Negative control: Omit primary antibody while maintaining all other steps

  • Specificity control: Compare staining patterns with those documented in literature, particularly in tissues with known TSK function (e.g., skin for wound healing studies)

What are common causes of non-specific binding with TSK antibodies and how can they be resolved?

Common causes of non-specific binding and their solutions:

TSK antibodies are known to recognize specific recombinant protein sequences. For example, some antibodies target the amino acid sequence: DTAHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHR . Understanding the epitope recognized by your antibody can help in troubleshooting by predicting potential cross-reactivity or accessibility issues.

How can I validate the specificity of TSK antibodies in my experimental system?

Multiple validation approaches should be employed:

• Genetic validation:

  • siRNA/shRNA knockdown of TSK in your experimental system

  • CRISPR-Cas9 knockout cells or tissues if available

  • Heterozygous TSK-lacZ knock-in mice can be used for TSK expression studies

• Biochemical validation:

  • Pre-absorption test: Pre-incubate antibody with excess recombinant TSK protein

  • Peptide competition: Pre-incubate with the immunizing peptide

  • Multiple antibodies: Use antibodies targeting different epitopes of TSK

• Expression pattern validation:

  • Compare staining/detection pattern with established TSK expression profiles

  • TSK is known to be expressed sequentially from macrophages to myofibroblasts during wound healing

  • For developmental studies, compare with established patterns in ectodermal and neural crest regions

• Technical controls:

  • Include isotype controls matching the TSK antibody

  • Verify secondary antibody specificity by omitting primary antibody

  • Utilize protein arrays containing TSK alongside other proteins to assess cross-reactivity (some commercial antibodies have been validated this way)

How can TSK antibodies be used to investigate the role of TSK in wound healing pathways?

TSK plays a crucial role in wound healing by regulating the transition from inflammation to proliferation phases. Researchers can utilize TSK antibodies to:

• Temporal-spatial expression analysis:

  • Use immunohistochemistry with TSK antibodies to track expression patterns at different timepoints (2-11 days post-wounding)

  • Co-staining with cell-type markers (macrophages, myofibroblasts) reveals the sequential expression from inflammatory cells to repair-associated cells

• Signaling pathway interrogation:

  • TSK controls macrophage function and myofibroblast differentiation by inhibiting TGF-β1

  • Employ TSK antibodies in immunoprecipitation experiments to isolate TSK-protein complexes

  • Perform co-immunoprecipitation with TGF-β1 antibodies to evaluate direct interactions

• Functional blocking studies:

  • Apply neutralizing TSK antibodies to wound models to evaluate functional outcomes

  • Measure changes in inflammatory markers, macrophage activation, and myofibroblast differentiation

• Cell-specific TSK depletion:

  • Use intracellular delivery of TSK antibodies in specific cell populations

  • Compare with results from TSK knockout models to understand cell-specific contributions

• Methodological approach for wound healing studies:

  • Create standardized wounds in animal models

  • Collect tissue at defined intervals (2, 7, 11 days post-wounding)

  • Process for immunohistochemistry with TSK antibodies

  • Co-stain with α-SMA (myofibroblast marker) and macrophage markers

  • Quantify TSK expression patterns relative to wound healing stages

What are the considerations for using TSK antibodies in studies of metabolic regulation and thermogenesis?

TSK functions as a hepatokine that gates energy expenditure via brown fat sympathetic innervation. When designing studies:

• Tissue-specific expression analysis:

  • Liver produces TSK as a secreted factor highly inducible in response to increased energy expenditure

  • Use TSK antibodies for immunohistochemistry or Western blot to quantify TSK expression in liver tissues under different metabolic conditions

  • Note that hepatic TSK expression and plasma TSK levels are elevated in obesity

• Functional studies design:

  • TSK deficiency increases sympathetic innervation and norepinephrine release in adipose tissue

  • Use TSK antibodies to track expression in models with manipulated TSK levels

  • Compare with physiological measurements (thermogenesis, adipose tissue innervation, obesity progression)

• Mechanistic pathway analysis:

  • TSK affects adrenergic signaling and brown fat function

  • Design co-immunoprecipitation experiments with TSK antibodies to identify binding partners

  • Analyze changes in downstream signaling molecules using phospho-specific antibodies

• Translational considerations:

  • TSK may be a potential therapeutic target for metabolic disease intervention

  • Develop experimental approaches using neutralizing TSK antibodies

  • Measure outcomes on energy expenditure and metabolic parameters

• Protocol recommendations:

  • For plasma TSK measurements, collect blood samples under controlled metabolic conditions

  • Process quickly and consistently to avoid degradation

  • Use validated TSK antibodies in ELISA or Western blot for quantification

  • Include appropriate controls (TSK-deficient samples if available)

How should researchers interpret discrepancies in TSK detection between different experimental techniques?

When facing discrepancies in TSK detection across methods:

• Epitope accessibility differences:

  • Western blot detects denatured proteins, potentially exposing epitopes hidden in native conformation

  • Immunohistochemistry preserves tissue architecture but may mask some epitopes

  • Solution: Use antibodies targeting different TSK epitopes across techniques

• Post-translational modifications:

  • TSK is a proteoglycan that may undergo glycosylation affecting antibody recognition

  • Different techniques may preserve or remove these modifications

  • Approach: Compare results with and without deglycosylation treatments

• Expression level thresholds:

  • Different techniques have varying sensitivity limits

  • Western blot may detect low expression levels not visible in IHC

  • Resolution: Employ signal amplification methods for less sensitive techniques

• Sample preparation impact:

  • As a secreted protein, TSK may be lost during certain preparation methods

  • For cellular studies, analyze both cell lysates and culture media

  • Recommendation: Include positive controls with known TSK expression patterns

• Quantification method standardization:

  • Establish consistent quantification methods across experiments

  • For Western blot: Normalize to appropriate loading controls

  • For IHC: Use digital imaging analysis with standardized parameters

What statistical approaches are recommended for analyzing TSK expression data across different experimental conditions?

For robust statistical analysis of TSK expression data:

• Sample size determination:

  • Calculate required sample size based on expected effect size from preliminary data

  • For tissue studies: minimum n=5-6 per group for adequate statistical power

  • For cell culture: 3-4 independent experiments with technical replicates

• Normalization strategies:

  • Western blot: Normalize TSK expression to total protein (Ponceau S) rather than housekeeping proteins that may vary under experimental conditions

  • qPCR: Use multiple reference genes validated for stability under your experimental conditions

  • IHC quantification: Normalize to tissue area or cell count

• Statistical tests selection:

  • For two-group comparisons: Student's t-test (parametric) or Mann-Whitney (non-parametric)

  • For multi-group comparisons: ANOVA with appropriate post-hoc tests (Tukey or Bonferroni)

  • For time-course data: Repeated measures ANOVA or mixed-effects models

• Correlative analyses:

  • Correlate TSK expression with functional outcomes

  • For wound healing: Pearson/Spearman correlation between TSK levels and healing parameters

  • For metabolic studies: Correlation with thermogenesis markers, adipose tissue innervation, or metabolic parameters

• Data presentation recommendations:

  • Display individual data points along with means and error bars

  • For Western blots: Show representative blots alongside quantification graphs

  • For IHC: Include representative images at consistent magnifications

How can TSK antibodies be incorporated into advanced techniques for studying protein-protein interactions?

Innovative approaches for studying TSK interactions include:

• Proximity ligation assay (PLA):

  • Use TSK antibodies paired with antibodies against suspected interaction partners

  • Allows visualization of protein interactions (<40 nm) in fixed cells/tissues

  • Applications: Study TSK interaction with TGF-β1 in wound healing or BMP/Wnt in developmental contexts

• FRET/BRET-based approaches:

  • Create fusion proteins with fluorescent/bioluminescent tags

  • Use TSK antibodies to validate expression and localization

  • Analyze energy transfer to measure direct protein interactions

• BioID or APEX proximity labeling:

  • Express TSK fused to biotin ligase (BioID) or APEX peroxidase

  • Use TSK antibodies to confirm expression and localization

  • Identify novel interaction partners through streptavidin pulldown and mass spectrometry

• Single-molecule imaging:

  • Label TSK antibodies with quantum dots or other bright fluorophores

  • Track individual TSK molecules and their interactions in live cells

  • Analyze diffusion characteristics to infer binding events

• Protocol outline for co-immunoprecipitation optimization:

  • Sample preparation: Lysate preparation with mild detergents to preserve interactions

  • Pre-clearing: Remove non-specific binding proteins with control IgG

  • Immunoprecipitation: Use TSK antibody bound to protein A/G beads

  • Washing: Multiple gentle washes to remove non-specific interactions

  • Elution and analysis: Western blot for suspected interaction partners

  • Controls: Include isotype control antibodies and input samples

What are the considerations for adapting machine learning approaches to design antibodies with enhanced specificity for TSK?

Machine learning for TSK antibody design should consider:

• Training data requirements:

  • Compile datasets of known antibody-antigen interactions, particularly for small leucine-rich proteoglycans

  • Include structural information when available

  • Recent advances in computational models allow prediction of antibody structures from amino acid sequences

• Design strategy optimization:

  • Use generative models to propose mutations to existing TSK antibody structures

  • Implement computational platforms that simulate binding affinity and specificity

  • Lawrence Livermore National Laboratory's approach of combining known antibody structures with machine learning algorithms to propose mutations could be adapted

• Epitope selection considerations:

  • Target unique regions of TSK to minimize cross-reactivity

  • Consider designing complementary peptides targeting specific disordered regions of TSK

  • Focus on regions that distinguish TSK from other leucine-rich repeat proteins

• Validation pipeline integration:

  • Design computational-experimental iteration process

  • Use free energy calculations to predict binding affinity before experimental testing

  • Implement feedback loops where experimental data refines computational models

• Implementation recommendations:

  • Use transfer learning approaches as demonstrated in recent antibody structure prediction research

  • Employ biophysics-informed modeling combined with selection experiments

  • Design antibodies with custom specificity profiles (either specific or cross-specific binding properties)