TP53INP2 Antibody

Shipped with Ice Packs
In Stock

Description

Overview of TP53INP2 Protein

TP53INP2 (Tumor Protein P53 Inducible Nuclear Protein 2) functions as a dual regulator of transcription and autophagy in mammalian cells. This 220 amino acid nuclear protein positively regulates autophagy and is required for autophagosome formation and processing. It acts as a scaffold protein that recruits MAP1LC3A, GABARAP, and GABARAPL2 and brings them to the autophagosome membrane by interacting with VMP1, where they trigger autophagosome development in cooperation with the BECN1-PI3-kinase class III complex . Additionally, TP53INP2 serves as a transcriptional activator of THRA and is expressed in developing murine brain and spinal cord, as well as in sensory and motor neuron tracts of the peripheral nervous system .

The protein is also known by several aliases including C20orf110, DOR (Diabetes and Obesity Regulated), PINH, p53-inducible protein U (PIG-U), and dJ1181N3.1 . The gene encoding TP53INP2 is located on human chromosome 20, which comprises approximately 2% of the human genome and contains nearly 63 million bases encoding over 600 genes .

Types and Formats

TP53INP2 antibodies are predominantly available as polyclonal antibodies derived from rabbit hosts. These antibodies recognize different epitopes of the TP53INP2 protein, providing researchers with options for specific experimental needs . Most commercially available TP53INP2 antibodies are unconjugated, allowing researchers flexibility in detection methods depending on their experimental design .

Polyclonal antibodies offer advantages in detecting proteins with low expression levels due to their ability to recognize multiple epitopes on the target protein. This characteristic makes them particularly valuable for studying TP53INP2, which may have varying expression patterns across different tissues and cellular conditions .

Target Specificity

TP53INP2 antibodies are engineered with different binding specificities, primarily targeting either the N-terminal or C-terminal regions of the protein. This specificity allows researchers to study different functional domains of TP53INP2 .

N-terminal specific antibodies, such as ABIN7303458, are generated using KLH-conjugated synthetic peptides encompassing sequences within the N-terminal region of human TP53INP2 . C-terminal specific antibodies, like ABIN929101 and NBP2-84309, are raised against synthetic peptides corresponding to the C-terminal region of the protein . The C-terminal targeted antibody NBP2-84309, for example, is directed against a specific peptide sequence: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY .

Species Reactivity

Commercial TP53INP2 antibodies exhibit varied reactivity profiles across species, as summarized in the table below:

Catalog NumberVendorHostTarget RegionSpecies Reactivity
ABIN7303458Antibodies-onlineRabbitN-TermHuman, Mouse, Rat
ABIN929101Antibodies-onlineRabbitC-TermHuman
NBP2-84309Novus BiologicalsRabbitC-TermHuman
ab129784AbcamRabbitSynthetic PeptideHuman
PA5-75928Thermo FisherRabbitNot specifiedHuman, Mouse, Rat
ARP58965_P050Aviva SystemsRabbitC-terminalHuman, Mouse, Rat, Cow, Dog, Guinea Pig

This diversity in species reactivity provides researchers with options for studying TP53INP2 across different model organisms, facilitating translational research .

Western Blotting

Western blotting represents one of the primary applications for TP53INP2 antibodies. These antibodies enable researchers to detect and quantify TP53INP2 protein expression in various cell and tissue lysates. For optimal results in Western blotting, manufacturers recommend specific dilutions, typically ranging from 0.2-1 μg/ml to 1.0 μg/ml .

The Bio-Techne/Novus Biologicals TP53INP2 antibody (NBP2-84309) has been validated for Western blot applications with human samples, including human A549 whole cell lysates at a recommended dilution of 1 μg/ml . Similarly, the Thermo Fisher antibody (PA5-75928) has been purified to >95% purity by SDS-PAGE and validated for Western blot applications .

Immunohistochemistry

TP53INP2 antibodies are extensively used for immunohistochemical analysis of formalin-fixed, paraffin-embedded tissue sections. This application allows visualization of TP53INP2 expression patterns in tissue contexts, providing insights into its localization and expression levels in normal and pathological specimens .

In cancer research, immunohistochemistry with TP53INP2 antibodies has been employed to analyze expression patterns in clinical specimens. For instance, in a study on bladder cancer, researchers used TP53INP2 antibodies (Bioworld, BS61399) to stain formalin-fixed, paraffin-embedded bladder cancer tissue sections. The staining protocol involved overnight incubation at 4°C with the TP53INP2 antibody after dewaxing, rehydration, antigen retrieval, and blocking. Color development was performed using DAB and hematoxylin counterstaining, with stained tissues classified into low and high expression groups based on staining intensity .

Abcam's TP53INP2 antibody (ab129784) has been validated for immunohistochemistry on paraffin-embedded human breast carcinoma tissue, demonstrating specificity when tested with and without the immunizing peptide at a 1/50 dilution .

Immunofluorescence

Immunofluorescence applications enable researchers to visualize subcellular localization of TP53INP2 in cultured cells. Multiple commercially available TP53INP2 antibodies have been validated for immunofluorescence, including those from Antibodies-online (ABIN7303458) and Abcam (ab129784) .

The Abcam antibody has been validated for immunofluorescence in MCF7 cells at a 1/100 dilution, providing detailed visualization of TP53INP2 subcellular distribution . This application is particularly valuable given TP53INP2's dynamic localization pattern during autophagy, where it translocates from the nucleus to autophagosome structures upon autophagy induction by rapamycin or starvation .

Additional Applications

Some TP53INP2 antibodies have been validated for additional applications such as immunochromatography (IC) and enzyme-linked immunosorbent assay (ELISA) . These applications extend the utility of TP53INP2 antibodies for diverse research purposes, including high-throughput protein quantification and diagnostic applications.

Cancer Research

TP53INP2 antibodies have been instrumental in advancing our understanding of cancer biology. Research utilizing these antibodies has revealed that TP53INP2 expression levels correlate with cancer progression and patient outcomes in certain malignancies.

A significant study employed TP53INP2 antibodies to demonstrate that high expression of TP53INP2 correlates with poor patient survival in bladder cancer. Further investigation showed that TP53INP2 depletion inhibits migration, invasion, and epithelial-to-mesenchymal transition (EMT) of bladder cancer cells . The mechanistic analysis revealed that TP53INP2 knockdown suppresses EMT by inhibiting active non-phosphorylated β-catenin and decreasing Snail1 levels. Additionally, the research established that this process involves the glycogen synthase kinase-3 beta (GSK-3β) pathway, as the GSK-3β inhibitor IM-12 abrogated the effect of TP53INP2 silencing .

Interestingly, the study also found that inducing autophagy partially reversed the TP53INP2 knockdown-induced decrease in active β-catenin and inhibition of migration and invasion in bladder cancer cells. This suggests a complex interplay between TP53INP2's roles in autophagy and cancer cell invasion .

Autophagy Research

TP53INP2 antibodies have contributed significantly to autophagy research, helping elucidate the protein's role in autophagosome formation. Research indicates that TP53INP2 is necessary for autophagosome development, functioning as a scaffold protein that recruits LC3 and/or LC3-related proteins such as GABARAP and GABARAP-like2 to the autophagosome membrane .

Recent research published in 2019 used TP53INP2 antibodies to demonstrate that TP53INP2 recruitment to phosphatidylinositol 3-phosphate (PtdIns3P)-positive early autophagic membranes relies on LC3 . This finding provides important insights into the molecular mechanisms underlying autophagosome formation and the specific role of TP53INP2 in this process.

Development and Tissue Expression

TP53INP2 antibodies have enabled researchers to map the expression pattern of TP53INP2 across different tissues during development. Studies have shown that TP53INP2 is expressed in developing murine brain and spinal cord, as well as in the sensory and motor neuron tracts of the peripheral nervous system . This expression pattern suggests potential roles for TP53INP2 in neuronal development and function, opening avenues for further research in neurobiology.

Purification Methods

Commercial TP53INP2 antibodies undergo rigorous purification processes to ensure specificity and minimize background reactivity. Many are purified via affinity chromatography using epitope-specific immunogens . For instance, the Thermo Fisher antibody (PA5-75928) is affinity-purified from rabbit antiserum using epitope-specific immunogen, achieving a purity exceeding 95% as verified by SDS-PAGE .

Validation and Controls

When working with TP53INP2 antibodies, appropriate controls are essential for ensuring specificity and interpreting results accurately. Some manufacturers provide blocking peptides that can serve as controls in assays to test for antibody specificity . For instance, Abcam demonstrates the specificity of their TP53INP2 antibody (ab129784) by showing immunohistochemistry results with and without the immunizing peptide, clearly illustrating the specificity of the staining pattern .

Product Specs

Form
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Lead Time
We typically dispatch products within 1-3 business days of receiving your order. Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Synonyms
Tp53inp2 antibody; Dor antibody; Trp53inp2 antibody; Tumor protein p53-inducible nuclear protein 2 antibody; Diabetes and obesity-regulated protein antibody
Target Names
Uniprot No.

Target Background

Function

TP53INP2 is a dual regulator of transcription and autophagy. It positively regulates autophagy and is essential for autophagosome formation and processing. TP53INP2 may act as a scaffold protein that recruits MAP1LC3A, GABARAP and GABARAPL2, bringing them to the autophagosome membrane by interacting with VMP1. Here, in cooperation with the BECN1-PI3-kinase class III complex, they trigger autophagosome development. TP53INP2 also acts as a transcriptional activator of THRA.

Gene References Into Functions
  1. TP53INP2 repression is a component of an adaptive mechanism that preserves muscle mass in situations where insulin action is deficient. PMID: 24713655
Database Links
Subcellular Location
Cytoplasm, cytosol. Nucleus. Nucleus, PML body. Cytoplasmic vesicle, autophagosome.

Q&A

What is the primary function of TP53INP2 in cellular processes?

TP53INP2 (Tumor Protein P53 Inducible Nuclear Protein 2) functions as a dual regulator of transcription and autophagy. It positively regulates autophagy and is essential for autophagosome formation and processing. The protein acts as a scaffold that recruits MAP1LC3A, GABARAP, and GABARAPL2 proteins and brings them to the autophagosome membrane by interacting with VMP1. There, in cooperation with the BECN1-PI3-kinase class III complex, these proteins trigger autophagosome development. Additionally, TP53INP2 acts as a transcriptional activator of THRA (thyroid hormone receptor alpha) .

What criteria should researchers consider when selecting a TP53INP2 antibody?

When selecting a TP53INP2 antibody, researchers should consider:

  • Application compatibility: Verify that the antibody has been validated for your specific application (WB, IHC, ICC/IF).

  • Species reactivity: Ensure the antibody recognizes TP53INP2 in your experimental species (human, mouse, rat).

  • Epitope region: Different antibodies target different regions (N-terminal, C-terminal, or specific amino acid sequences). Choose based on your research question and protein domains of interest.

  • Clonality: Polyclonal antibodies offer broader epitope recognition, while monoclonal antibodies provide higher specificity.

  • Validation data: Review images showing performance in applications similar to yours.

  • Cross-reactivity: Check for potential cross-reactivity with related proteins .

How can researchers validate the specificity of a TP53INP2 antibody?

To validate TP53INP2 antibody specificity, researchers should:

  • Perform peptide competition assays: Compare staining with and without the immunizing peptide. As shown in the search results, the signal disappears when the immunizing peptide is present, confirming specificity .

  • Use positive and negative controls: Test the antibody on tissues or cell lines known to express or lack TP53INP2 (e.g., BT20 cells with high expression vs. MCF7 cells with undetectable levels) .

  • Knockdown validation: Compare staining between wild-type cells and TP53INP2 knockdown cells to confirm signal reduction.

  • Western blot analysis: Verify that the antibody detects a band of the expected molecular weight.

  • Multiple antibody approach: Use antibodies targeting different epitopes of TP53INP2 to confirm consistent results .

What are the optimal conditions for using TP53INP2 antibodies in immunohistochemistry?

For optimal immunohistochemistry (IHC) using TP53INP2 antibodies:

  • Dilution: Start with manufacturer-recommended dilutions (e.g., 1/50 for paraffin-embedded tissues as indicated for ab129784) .

  • Antigen retrieval: Use appropriate antigen retrieval methods, typically heat-induced epitope retrieval in citrate buffer (pH 6.0) or EDTA buffer (pH 9.0).

  • Blocking: Implement thorough blocking steps to reduce background staining.

  • Incubation time and temperature: Primary antibody incubation is typically overnight at 4°C or 1-2 hours at room temperature.

  • Detection system: Choose a detection system compatible with rabbit polyclonal antibodies.

  • Controls: Include positive control tissues (breast carcinoma tissues have been validated) and negative controls (omitting primary antibody or using competing peptide) .

What protocols are recommended for TP53INP2 detection by Western blotting?

For Western blot detection of TP53INP2:

  • Sample preparation: Prepare cell or tissue lysates using RIPA or NP-40 buffer containing protease inhibitors.

  • Protein loading: Load 20-50 μg of total protein per lane.

  • Gel percentage: Use 10-12% SDS-PAGE gels for optimal separation.

  • Transfer: Transfer proteins to PVDF or nitrocellulose membranes.

  • Blocking: Block with 5% non-fat milk or BSA in TBST for 1 hour at room temperature.

  • Antibody dilution: Use the TP53INP2 antibody at recommended dilutions (typically 1:500-1:2000).

  • Incubation: Incubate with primary antibody overnight at 4°C.

  • Detection: Use HRP-conjugated secondary antibodies and ECL detection systems.

  • Expected molecular weight: Look for the appropriate band size specific to TP53INP2 .

How can TP53INP2 antibodies be used to study the protein's role in autophagy regulation?

TP53INP2 antibodies can be employed to investigate autophagy regulation through:

  • Co-immunoprecipitation (Co-IP): Use TP53INP2 antibodies to pull down the protein and analyze its interaction with autophagy-related proteins such as MAP1LC3A, GABARAP, GABARAPL2, and VMP1.

  • Immunofluorescence microscopy: Perform dual staining with TP53INP2 and autophagy markers to visualize co-localization patterns during autophagy induction.

  • Subcellular fractionation: Combine with Western blotting to track TP53INP2 translocation between nucleus and cytoplasm during autophagy.

  • Autophagic flux assays: Use TP53INP2 antibodies alongside LC3-II and p62 antibodies to assess the impact of TP53INP2 manipulation on autophagic flux.

  • Live-cell imaging: Combine with fluorescently-tagged autophagy proteins to monitor real-time dynamics of TP53INP2 during autophagosome formation .

What approaches can researchers use to investigate TP53INP2's role in death receptor signaling?

To investigate TP53INP2's role in death receptor signaling, researchers can:

  • Ubiquitination assays: Use TP53INP2 antibodies in immunoprecipitation followed by ubiquitin immunoblotting to assess caspase-8 ubiquitination levels in the presence or absence of TP53INP2.

  • Proximity ligation assays: Detect in situ interactions between TP53INP2, caspase-8, and TRAF6 to visualize complex formation.

  • TRAIL sensitivity testing: Compare TRAIL-induced apoptosis in cell lines with different TP53INP2 expression levels, using the antibody to confirm expression status.

  • Mutational analysis: Study the effects of TIM (TRAF6-interacting motif) and UIM (ubiquitin-interacting motif) mutations on TP53INP2's interaction with TRAF6 and caspase-8.

  • Triple co-immunoprecipitation: Use TP53INP2 antibodies to demonstrate the formation of a complex containing TP53INP2, TRAF6, and caspase-8 .

How should researchers interpret varying TP53INP2 expression patterns across cancer cell lines?

When interpreting TP53INP2 expression across cancer cell lines:

  • Correlation with apoptotic sensitivity: High TP53INP2 expression (e.g., in BT20 breast cancer cells) correlates with increased sensitivity to TRAIL-induced apoptosis (r=0.84 in breast cancer lines, r=0.87 in liver cancer lines) .

  • Subcellular localization analysis: Consider both expression level and localization pattern, as nuclear-to-cytoplasmic shuttling is crucial for function.

  • Context-dependent interpretation: Evaluate expression in conjunction with other death receptor pathway components.

  • Cancer type specificity: TP53INP2 expression patterns and their significance may vary between cancer types.

  • Functional validation: Confirm the significance of expression differences through knockdown or overexpression experiments followed by functional assays .

What are common technical challenges when working with TP53INP2 antibodies and how can they be addressed?

Common technical challenges with TP53INP2 antibodies include:

  • Background staining: Optimize blocking conditions using different blocking agents (BSA, normal serum, commercial blockers) and increase washing steps.

  • Epitope masking: Try different antigen retrieval methods if working with fixed tissues or cells.

  • Degradation issues: Use fresh samples and add protease inhibitors during sample preparation.

  • Inconsistent results between applications: Different applications may require different antibodies targeting specific epitopes; consider application-specific validated antibodies.

  • Cross-reactivity: Perform careful controls, including peptide competition assays and knockdown validations.

  • Nuclear protein extraction difficulties: Use specialized nuclear extraction protocols to ensure complete extraction of nuclear TP53INP2 .

How can TP53INP2 antibodies be utilized to evaluate its potential as a biomarker for TRAIL therapy response?

To evaluate TP53INP2 as a biomarker for TRAIL therapy response:

  • Tissue microarray analysis: Use TP53INP2 antibodies to screen patient tumor samples for expression levels and correlate with clinical response to TRAIL-based therapies.

  • Cell line profiling: Screen panels of cancer cell lines for TP53INP2 expression levels and correlate with TRAIL sensitivity (as demonstrated in breast and liver cancer cell lines) .

  • Paired sample analysis: Compare TP53INP2 expression in matched pre- and post-treatment samples to assess alterations during treatment.

  • Combination with other biomarkers: Analyze TP53INP2 expression alongside other death receptor pathway components to develop a comprehensive predictive panel.

  • Functional validation: In cell lines with varying TP53INP2 levels, measure apoptotic response to TRAIL treatment using annexin V staining and DEVDase activity assays .

What methodological approaches can be used to study the interplay between TP53INP2's role in autophagy and apoptosis?

To investigate the interplay between TP53INP2's autophagy and apoptosis functions:

  • Genetic manipulation strategies: Use CRISPR/Cas9 to generate domain-specific mutants that selectively disrupt either autophagy regulation (LIR mutations) or death receptor signaling (TIM mutations).

  • Temporal analysis: Employ time-lapse microscopy with TP53INP2 antibodies to track its relocalization during the transition from autophagy to apoptosis.

  • Dual pathway modulation: Combine autophagy inducers/inhibitors with death receptor ligands to assess pathway crosstalk.

  • Protein-protein interaction network analysis: Use TP53INP2 antibodies for immunoprecipitation followed by mass spectrometry to identify the complete interactome under different cellular conditions.

  • Single-cell analysis: Employ flow cytometry or imaging cytometry with TP53INP2 antibodies to correlate individual cell expression levels with autophagic and apoptotic markers .

How does the function of TP53INP2 compare to that of other p53-inducible proteins?

TP53INP2, while named as a p53-inducible protein, has distinct functions compared to other p53-inducible proteins:

  • Dual functionality: Unlike many p53-inducible proteins that primarily function in one pathway, TP53INP2 has dual roles in transcriptional regulation and autophagy .

  • Death receptor specificity: TP53INP2 specifically enhances extrinsic apoptosis through death receptors, while many other p53-inducible proteins primarily affect intrinsic apoptosis pathways .

  • Scaffold function: TP53INP2 uniquely functions as a scaffold protein for caspase-8 ubiquitination by TRAF6, a mechanism not shared by other p53-related proteins .

  • Subcellular shuttling: TP53INP2's ability to shuttle between nucleus and cytoplasm depending on cellular conditions distinguishes it from proteins with more stable localizations .

  • TRAIL sensitivity correlation: Its levels correlate with TRAIL sensitivity in cancer cells, potentially making it a unique biomarker in this context .

What technical considerations should be addressed when comparing different commercial TP53INP2 antibodies?

When comparing different commercial TP53INP2 antibodies, researchers should consider:

  • Epitope differences: Antibodies targeting different regions (N-terminal, C-terminal, or specific domains) may yield different results based on protein interactions or post-translational modifications that mask epitopes.

  • Validation extent: Evaluate the comprehensiveness of validation data provided by manufacturers across different applications and cell/tissue types.

  • Cross-reactivity profiles: Compare documented cross-reactivity with related proteins or in non-target species.

  • Batch-to-batch consistency: Consider manufacturers with established quality control processes to ensure consistent performance.

  • Application optimization: Different antibodies may require distinct optimization protocols for specific applications; compare recommended conditions.

  • Publication record: Review published studies that have successfully used specific antibodies for applications similar to yours .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.