Triosephosphate isomerase Antibody

What is Triosephosphate isomerase and what is its role in glycolysis?

Human TPI is encoded by the TPI1 gene, with a molecular weight of approximately 27 kDa . The enzyme is primarily located in the cytoplasm but has also been detected in the nucleus and extracellular matrix .

What types of Triosephosphate isomerase antibodies are commercially available for research?

Several types of Triosephosphate isomerase antibodies are available for research applications:

• Polyclonal antibodies: Typically raised in rabbits using either recombinant fusion proteins containing amino acids 1-249 of human TPI1 or KLH-conjugated synthetic peptides derived from human Triosephosphate isomerase . These recognize multiple epitopes on the TPI protein.

• Monoclonal antibodies: These offer higher specificity by targeting single epitopes. For example, the monoclonal antibody 4H11D10B11 specifically recognizes Triosephosphate isomerase from Taenia solium (TTPI) .

• Host species options: Commonly available in rabbit-derived formats, with varying immunization strategies and purification methods depending on the manufacturer .

• Application-optimized antibodies: Some are specifically validated for particular techniques such as Western blotting, ELISA, immunohistochemistry, or immunofluorescence.

The choice of antibody depends on experimental requirements, including target species, application, and detection sensitivity needs.

What are the validated applications for Triosephosphate isomerase antibodies?

Triosephosphate isomerase antibodies have been validated for multiple research applications:

These antibodies are valuable for:

• Studying TPI expression patterns in normal and disease states

• Investigating glycolytic enzyme dysfunction in TPI deficiency

• Examining the potential role of TPI in neurological disorders like multiple sclerosis

• Analyzing species-specific TPI variants in infectious disease research

• Serving as loading controls in specific experimental contexts

What are the recommended storage and handling protocols for Triosephosphate isomerase antibodies?

Proper storage and handling are essential for maintaining antibody functionality:

Storage conditions:

• Most TPI antibodies ship at 4°C and should be stored at -20°C upon delivery

• They are typically supplied in PBS (pH 7.3) with 50% glycerol and preservatives (e.g., 0.05% Proclin300)

• Avoid repeated freeze/thaw cycles by making small aliquots for long-term storage

Handling guidelines:

• Thaw aliquots completely before use and mix gently to ensure homogeneity

• Keep antibodies on ice during experimental setup

• For dilutions, use appropriate buffers as recommended in product documentation

• Return to -20°C storage promptly after use

• For Western blotting, dilutions typically range from 1:500-1:1,000

• For immunohistochemistry applications, optimal dilutions may range from 1:50-1:500 depending on the specific protocol and detection method

Following these guidelines helps ensure consistent antibody performance across experiments.

How can the specificity of Triosephosphate isomerase antibodies be validated?

Validating TPI antibody specificity is crucial for generating reliable research data. Several methodological approaches should be considered:

1. Western blot validation:

• Confirm detection of a single band at the expected molecular weight (27 kDa for TPI)

• Include positive controls (recombinant TPI) and negative controls

• Assess cross-reactivity with predicted reactive species (e.g., human, mouse, rat)

2. Peptide competition assays:

• Pre-incubate the antibody with excess immunizing peptide before application

• Specific signals should be significantly reduced or eliminated when the antibody is neutralized

• This approach can confirm that the observed signal is due to specific binding to the intended epitope

3. Epitope mapping:

• Synthetic peptides containing sequences from different regions of TPI can be used to determine specificity

• For example, the epitope recognized by monoclonal antibody 4H11D10B11 was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI)

• Further analysis suggested the epitope spans the sequence WIRKHVDAGIAD (residues 193-204)

4. Species cross-reactivity:

• Test antibody against TPI from different species to confirm specificity claims

• The 4H11D10B11 monoclonal antibody demonstrated specificity by failing to recognize TPI from humans and pigs

• This validation is particularly important for studies involving multiple species or host-pathogen interactions

These validation approaches provide confidence that experimental results reflect true TPI biology rather than non-specific interactions.

What are the optimal experimental conditions for using Triosephosphate isomerase antibodies in Western blotting?

For optimal Western blot results with TPI antibodies, researchers should follow these methodological guidelines:

Sample preparation:

• Use RIPA buffer or similar lysis buffers containing protease inhibitors

• Load 10-30 μg of total protein per lane

• Denature samples at 95°C for 5 minutes in reducing sample buffer

Gel electrophoresis:

• Use 10-12% SDS-PAGE gels for optimal resolution of the 27 kDa TPI protein

• Include molecular weight markers that clearly delineate the 25-30 kDa range

Transfer and blocking:

• Transfer to PVDF or nitrocellulose membranes using standard protocols

• Block with 5% non-fat dry milk or 3-5% BSA in TBST for 1 hour at room temperature

Antibody incubation:

• Dilute primary antibody according to manufacturer recommendations, typically 1:500-1:1,000 for TPI antibodies

• Incubate overnight at 4°C or for 1-2 hours at room temperature

• Wash thoroughly with TBST (3-5 washes, 5-10 minutes each)

• Incubate with appropriate HRP-conjugated secondary antibody (typically anti-rabbit IgG for most TPI antibodies)

Detection and troubleshooting:

• Use enhanced chemiluminescence for visualization

• Expected molecular weight: approximately 27 kDa

• If high background occurs, increase antibody dilution or optimize blocking conditions

• For weak signals, decrease antibody dilution or increase protein loading

Following these guidelines should provide clear and specific detection of TPI in Western blot applications.

How can researchers distinguish between human and non-human Triosephosphate isomerase in experimental systems?

Differentiating between human and non-human TPI is critical for many research contexts, including host-pathogen studies. Several approaches can be employed:

1. Species-specific antibodies:

• Select antibodies raised against non-conserved regions of TPI

• Monoclonal antibodies often offer better species specificity than polyclonals

• For example, the 4H11D10B11 monoclonal antibody specifically recognizes T. solium TPI without cross-reactivity to human or pig TPI

2. Epitope mapping for antibody selection:

• Analyze TPI sequence alignments across relevant species to identify unique regions

• Target these divergent regions for antibody generation or selection

• The epitope spanning residues 193-204 (WIRKHVDAGIAD) in T. solium TPI is located within helix 6, near the catalytically important loop 6

3. Differential inhibition assays:

• Some antibodies selectively inhibit TPI activity from specific species

• The 4H11D10B11 antibody inhibited T. solium TPI activity by 74% but had no effect on human TPI

• This differential inhibition can be used as a functional readout for species identification

4. Kinetic analysis:

• Non-competitive inhibition profiles (as observed with 4H11D10B11) indicate binding outside the catalytic site

• This information can guide interpretation of species-specific effects

These methodological approaches allow researchers to specifically identify and study TPI from different species in the same experimental system, crucial for host-pathogen interaction studies and other comparative analyses.

What controls should be included when using Triosephosphate isomerase antibodies in immunological techniques?

Proper controls are essential when using TPI antibodies to ensure valid and interpretable results:

1. Positive controls:

• Recombinant TPI protein at known concentrations

• Cell lines or tissues with well-characterized TPI expression

• For human TPI studies, common positive controls include HeLa, HEK293, or A431 cell lysates

2. Negative controls:

• Samples where TPI expression is absent or minimal

• For species-specificity studies, TPI from non-target species (e.g., using human TPI as a negative control when studying parasite-specific TPI)

3. Antibody controls:

• Isotype controls: Matching non-specific IgG at the same concentration (e.g., rabbit IgG for rabbit-derived TPI antibodies)

• Secondary antibody only: Omitting primary antibody to assess non-specific binding of secondary antibody

• Peptide competition: Pre-incubation of antibody with immunizing peptide to demonstrate binding specificity

4. Method-specific controls:

• For Western blotting: Loading controls (e.g., GAPDH, β-actin) to normalize protein amounts

• For IHC/IF: No-primary antibody controls and tissue controls with known TPI expression patterns

• For ELISA: Standard curves using purified TPI protein at known concentrations

5. Cross-reactivity controls:

• When studying TPI in complex biological systems (e.g., host-pathogen models), include samples containing only host or only pathogen TPI

• Particularly important when studying parasites like T. solium in human or pig tissues

These comprehensive controls help distinguish true biological findings from technical artifacts and support reliable interpretation of experimental results.

How are Triosephosphate isomerase antibodies used to study TPI deficiency and related glycolytic enzymopathies?

TPI antibodies are valuable tools for investigating TPI deficiency, a unique glycolytic enzymopathy characterized by severe neurological symptoms:

1. Molecular diagnosis and characterization:

• Western blotting with TPI antibodies can quantify protein levels in patient samples

• Reduced protein levels may confirm enzyme deficiency even when activity assays show residual function

• Antibodies can help distinguish between mutations affecting protein stability versus catalytic activity

2. Structure-function analysis:

• TPI antibodies can immunoprecipitate wild-type and mutant TPI for comparative biochemical analysis

• This approach helps correlate structural alterations with functional deficits and clinical phenotypes

• Such studies reveal that TPI deficiency is unique among glycolytic enzymopathies in the severity of neurological symptoms

3. Non-catalytic function investigation:

• Evidence suggests TPI has important non-catalytic functions beyond its enzymatic role

• Antibodies are instrumental in identifying protein-protein interactions involving TPI

• These non-enzymatic functions may explain why TPI deficiency causes uniquely severe neurological symptoms compared to other glycolytic enzymopathies

4. In vivo models:

• TPI antibodies help validate animal models of TPI deficiency by confirming protein reduction

• They enable tissue-specific analysis of TPI expression patterns in disease models

• This facilitates understanding of tissue-selective manifestations, particularly neurological symptoms

5. Therapeutic development:

• Antibodies assist in screening compounds that might stabilize mutant TPI

• They provide readouts for assessing enzyme replacement or gene therapy approaches

These approaches contribute to understanding why TPI deficiency results in more severe neurological manifestations than deficiencies of other glycolytic enzymes.

What role does Triosephosphate isomerase play in autoimmune neurological disorders like multiple sclerosis?

Recent research has revealed intriguing connections between TPI and neurological autoimmunity, particularly in multiple sclerosis (MS):

1. Autoantibody profiling in MS patients:

• Analysis of cerebrospinal fluid (CSF) from MS patients has identified TPI as a target of autoantibodies

• Elevated levels of TPI-reactive antibodies were detected in:

  • 46% of MS patients

  • 40% of patients with clinically isolated syndrome (CIS) suggestive of MS

  • 29% of patients with other inflammatory neurological diseases (OIND)

  • 31% of patients with other non-inflammatory neurological diseases (ONIND)

2. Multi-target autoimmune responses:

• Co-occurrence of autoantibodies to both TPI and GAPDH (another glycolytic enzyme) was found in:

  • 29% of MS patients

  • 3% of CIS patients

  • 0% of OIND/ONIND patients

• This pattern suggests a potentially MS-specific autoimmune response against multiple glycolytic enzymes

3. B-cell clonality studies:

• Single chain variable fragment antibodies (scFv-Abs) generated from clonal B cells in MS patient CSF showed reactivity to TPI

• Similar scFv-Abs were also generated from MS brain lesions

• This provides direct evidence linking intrathecal antibody production to glycolytic enzyme targeting

4. Axonal pathology mechanisms:

• TPI antibodies bind to axons in MS brains, potentially disrupting neuronal energy metabolism

• Glycolytic enzyme dysfunction may contribute to the energy failure hypothesis of axonal degeneration in MS

• The findings suggest that TPI and GAPDH may be candidate antigens for an autoimmune response to neurons and axons in MS

These discoveries open new avenues for understanding MS pathogenesis and potential therapeutic approaches targeting glycolytic enzyme autoimmunity.

How can inhibitory monoclonal antibodies against Triosephosphate isomerase be characterized?

Characterizing inhibitory monoclonal antibodies against TPI requires a systematic approach, as demonstrated with the 4H11D10B11 monoclonal antibody against T. solium TPI:

1. Binding specificity assessment:

• Confirm antibody binding to target TPI using multiple methods:

  • ELISA for quantitative binding assessment

  • Western blot for specificity verification at the expected molecular weight

• The 4H11D10B11 mAb specifically recognized T. solium TPI through both these methods

2. Enzymatic inhibition quantification:

• Measure TPI enzymatic activity in the presence and absence of the antibody

• The 4H11D10B11 mAb inhibited T. solium TPI activity by 74%

• Antigen-binding fragments (Fabs) from this antibody retained nearly the same inhibitory capability, indicating that inhibition requires only the binding portion of the antibody

3. Epitope mapping:

• Use synthetic peptides representing different regions of the TPI sequence

• Test antibody binding to these peptides via ELISA

• The epitope for 4H11D10B11 was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI)

• Further analysis using phage display and mimotope techniques refined the epitope to WIRKHVDAGIAD (residues 193-204)

4. Structural context analysis:

• The identified epitope (residues 193-204) is located within helix 6, adjacent to loop 6

• Loop 6 is essential for catalysis in TPI

• This structural relationship explains how antibody binding could inhibit enzyme activity without directly occluding the catalytic site

5. Inhibition mechanism characterization:

• Kinetic analysis revealed non-competitive inhibition by the 4H11D10B11 antibody

• This confirms that the antibody does not bind directly to the catalytic site but rather changes enzyme conformation or dynamics in a way that reduces activity

This comprehensive characterization approach provides insights into both antibody specificity and TPI structure-function relationships.

What epitope mapping strategies are most effective for Triosephosphate isomerase antibodies?

Multiple complementary epitope mapping strategies can be employed for TPI antibodies, each with distinct advantages:

1. Synthetic peptide arrays:

• Generate overlapping peptides spanning the entire TPI sequence

• Test antibody binding to each peptide via ELISA

• This approach successfully identified that monoclonal antibody 4H11D10B11 binds to peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI) from T. solium TPI

• Advantages: relatively simple, good for linear epitopes; limitations: may miss conformational epitopes

2. Phage display techniques:

• Generate phage libraries displaying random peptide sequences

• Select phages that bind to the antibody of interest

• Sequence the peptides displayed by binding phages

• Analyze consensus sequences to identify mimotopes

• This approach refined the 4H11D10B11 epitope to WIRKHVDAGIAD (residues 193-204)

• Advantages: can detect both linear and conformational epitopes; limitations: requires specialized expertise

3. Structural analysis:

• Locate mapped epitopes within the three-dimensional structure of TPI

• The epitope spanning residues 193-204 is within helix 6, adjacent to catalytically important loop 6

• This explains how antibody binding inhibits enzyme activity without directly blocking the active site

• Non-competitive inhibition profiles further confirm binding outside the catalytic site

4. Species cross-reactivity analysis:

• Compare antibody binding to TPI from different species

• The 4H11D10B11 antibody did not recognize TPI from humans or pigs (hosts of T. solium)

• This specificity correlates with sequence variations in the identified epitope region between species

• Provides validation of epitope mapping and insights into structural determinants of specificity

These complementary approaches provide comprehensive epitope characterization, supporting both basic research on TPI structure-function relationships and applied research for diagnostic or therapeutic antibody development.