tnfaip8l2b Antibody

What is TNFAIP8L2 and what are its primary biological functions?

TNFAIP8L2, commonly known as TIPE2 (Tumor Necrosis Factor Alpha-Induced Protein 8-Like Protein 2), is a 184-amino acid protein that functions as a negative regulator of inflammation and immunity. It belongs to the TNFAIP8 family and plays crucial roles in maintaining immune homeostasis through:

• Negative regulation of both innate and adaptive immune responses

• Inhibition of activating protein-1 (AP-1) and nuclear factor kappa B (NF-κB) activation

• Regulation of cellular apoptotic processes

• Modulation of toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways

The protein contains specific phosphorylation sites at S3, T88, and T136, which are important for its regulatory functions and may affect antibody recognition depending on phosphorylation status .

What are the key structural features of TNFAIP8L2 relevant to antibody development?

TNFAIP8L2 contains several distinct regions that serve as important epitopes for antibody development:

• N-terminal domain (residues 1-36): Contains phosphorylation site S3

• Middle region (residues 36-66): Common target for antibody development due to accessibility and uniqueness

• Central core region (residues 67-150): Contains phosphorylation sites T88 and T136

• C-terminal region (residues 151-184): Contains sequence variations that differentiate it from other TNFAIP8 family members

The complete amino acid sequence includes specific motifs that determine antibody specificity: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL .

How does species cross-reactivity influence TNFAIP8L2 antibody selection?

TNFAIP8L2 antibodies exhibit variable cross-reactivity patterns that researchers must consider:

• Most commercially available antibodies show confirmed reactivity with human, mouse, and rat TNFAIP8L2

• Sequence homology predicts potential cross-reactivity with pig, bovine, horse, sheep, rabbit, dog, and Xenopus, but with varying confidence levels

• When studying non-validated species, preliminary validation experiments are essential before proceeding with full experimental protocols

• Sequence alignment analysis between target species should be performed to predict potential cross-reactivity issues and epitope conservation

What are the optimal applications for different types of TNFAIP8L2 antibodies?

Different TNFAIP8L2 antibodies are optimized for specific applications based on their epitope recognition and formulation:

• N-terminal targeting antibodies (AA 36-66): Particularly effective for Western blotting and enzyme immunoassays due to stability of this region during denaturation

• Full-length antibodies (AA 1-184): Versatile for multiple applications including WB, IF, and IP, offering broader epitope recognition

• Middle-region antibodies (AA 10-110): Optimal for immunofluorescence applications in both cultured cells and paraffin-embedded sections

Application-specific considerations:

• Western Blot: Antibodies targeting denaturation-resistant epitopes are preferred

• Immunofluorescence: Antibodies recognizing native conformations show better performance

• Immunoprecipitation: Higher affinity antibodies with low background binding are recommended

How should sample preparation be optimized when working with TNFAIP8L2 antibodies?

Sample preparation significantly impacts TNFAIP8L2 antibody performance:

• Cell lysis protocols: Use RIPA buffer containing protease inhibitors for Western blot applications; milder detergents like NP-40 are preferred for maintaining protein complexes in immunoprecipitation

• Tissue preparation: Fixation time is critical in immunohistochemistry; over-fixation can mask TNFAIP8L2 epitopes

• Antigen retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) improves detection in paraffin sections

• Blocking conditions: 5% BSA in TBS-T typically provides optimal blocking while preserving TNFAIP8L2 epitope accessibility

• Storage considerations: Avoid multiple freeze-thaw cycles of protein samples as they can affect epitope integrity and phosphorylation status of S3, T88, and T136 residues

What controls are essential when validating experimental results with TNFAIP8L2 antibodies?

Rigorous experimental controls are critical for reliable TNFAIP8L2 research:

• Positive controls: Cell lines with confirmed TNFAIP8L2 expression (e.g., immune cells, particularly macrophages)

• Negative controls: TNFAIP8L2 knockout/knockdown samples or cell lines with minimal expression

• Peptide competition assays: Pre-incubation with the immunizing peptide should abolish specific signal

• Isotype controls: Match the host species and antibody class to control for non-specific binding

• Cross-validation: Compare results using antibodies targeting different epitopes of TNFAIP8L2 (N-terminal vs. internal region)

How can phospho-specific TNFAIP8L2 antibodies be utilized to study post-translational modifications?

TNFAIP8L2 undergoes specific phosphorylation events that regulate its function:

Research approaches for studying these modifications include:

• Phospho-specific antibodies: Development of antibodies specifically recognizing phosphorylated S3, T88, or T136

• Phosphatase treatment: Sample treatment with lambda phosphatase to confirm phosphorylation-dependent antibody recognition

• Mutation studies: Utilization of phospho-mimetic (S/T→D/E) or phospho-deficient (S/T→A) mutants to study functional impacts

• Kinase inhibition: Treatment with specific kinase inhibitors to identify regulatory pathways affecting TNFAIP8L2 phosphorylation

What strategies can resolve discrepancies between TNFAIP8L2 antibodies targeting different epitopes?

Researchers frequently encounter contradictory results when using different TNFAIP8L2 antibodies:

• Epitope mapping: Identify the exact binding regions of each antibody through peptide arrays or deletion mutants

• Conformational considerations: N-terminal antibodies (AA 36-66) may detect denatured protein more effectively than antibodies targeting conformational epitopes

• Post-translational modifications: Phosphorylation at S3, T88, or T136 may block epitope recognition by certain antibodies

• Splice variant specificity: Confirm whether antibodies recognize all or specific TNFAIP8L2 isoforms

• Cross-validation approach: Use multiple antibodies targeting different regions in parallel experiments

How can multicolor immunofluorescence be optimized when using TNFAIP8L2 antibodies?

Advanced multicolor immunofluorescence with TNFAIP8L2 antibodies requires:

• Antibody panel design: When combining with other markers, select TNFAIP8L2 antibodies conjugated to compatible fluorophores (e.g., AbBy Fluor® 750 for far-red spectrum to avoid overlap)

• Sequential staining: For unconjugated antibodies, use sequential rather than simultaneous incubation to minimize cross-reactivity

• Spectral unmixing: Apply spectral unmixing algorithms when using fluorophores with overlapping emission spectra

• Blocking optimization: Use species-specific blocking reagents when combining antibodies from different host species

• Colocalization analysis: Employ quantitative colocalization metrics (Pearson's coefficient, Manders' coefficient) for objective interpretation

How can non-specific binding be minimized when using TNFAIP8L2 antibodies in Western blotting?

Non-specific binding in Western blotting can be addressed through:

• Blocking optimization: Test different blocking agents (5% milk, 5% BSA, commercial blockers) to determine optimal conditions

• Antibody dilution: Titrate antibody concentration to find the optimal dilution that maximizes specific signal while minimizing background

• Washing stringency: Increase TBST washing time and frequency to remove weakly bound antibodies

• Incubation temperature: Perform antibody incubation at 4°C overnight rather than at room temperature to improve specificity

• Membrane selection: PVDF membranes typically provide better results than nitrocellulose for TNFAIP8L2 detection

What factors influence reproducibility in immunohistochemistry using TNFAIP8L2 antibodies?

Key factors affecting IHC reproducibility include:

• Fixation protocol: Standardize fixation time and conditions (4% paraformaldehyde is typically optimal)

• Antigen retrieval: Optimize pH and duration of heat-induced epitope retrieval (citrate buffer pH 6.0 is recommended)

• Antibody validation: Confirm antibody specificity using positive and negative control tissues

• Detection system: Amplification systems like tyramide signal amplification may be necessary for low-abundance TNFAIP8L2

• Quantification methods: Use digital image analysis with consistent thresholding parameters for objective quantification

How can researchers address inconsistent results between different applications using the same TNFAIP8L2 antibody?

When facing application-specific inconsistencies:

• Epitope accessibility: Native vs. denatured conditions affect epitope exposure differently; N-terminal antibodies generally perform better in denatured conditions

• Fixation impact: Chemical fixatives can modify epitopes differently than denaturation in SDS

• Concentration optimization: Each application requires specific antibody dilution optimization

• Buffer compatibility: Certain buffers may affect antibody performance differently across applications

• Cross-validation: Use orthogonal techniques (e.g., mass spectrometry) to confirm protein identity and modification state

How are TNFAIP8L2 antibodies being utilized in inflammatory disease research?

TNFAIP8L2 antibodies are enabling significant advances in inflammatory disease research:

• Tissue expression profiling: Characterizing TNFAIP8L2 expression patterns across different inflammatory conditions

• Signaling pathway analysis: Investigating how TNFAIP8L2 modulates NF-κB and AP-1 signaling cascades

• Macrophage polarization: Studying the role of TNFAIP8L2 in M1/M2 macrophage balance

• Therapeutic target validation: Evaluating TNFAIP8L2 as a potential target for anti-inflammatory interventions

• Biomarker development: Assessing TNFAIP8L2 levels as indicators of inflammatory disease activity

What is the significance of TNFAIP8L2 in cancer research and how are antibodies facilitating these studies?

TNFAIP8L2 antibodies are instrumental in elucidating its role in cancer:

• Tumor microenvironment: Analyzing TNFAIP8L2 expression in tumor-infiltrating immune cells

• Cancer cell studies: Investigating the potential tumor-suppressive functions of TNFAIP8L2

• Prognostic marker assessment: Evaluating TNFAIP8L2 expression correlation with clinical outcomes

• Therapeutic response prediction: Studying TNFAIP8L2 expression as a potential predictor of immunotherapy response

• Mechanistic investigations: Determining how TNFAIP8L2 regulates immune surveillance in the tumor microenvironment

What emerging techniques are enhancing the utility of TNFAIP8L2 antibodies in single-cell analysis?

Cutting-edge applications include:

• Single-cell western blotting: Detecting TNFAIP8L2 expression heterogeneity at the single-cell level

• Mass cytometry (CyTOF): Incorporating metal-conjugated TNFAIP8L2 antibodies for high-dimensional single-cell profiling

• Imaging mass cytometry: Visualizing TNFAIP8L2 expression in the spatial context of tissues at subcellular resolution

• Proximity ligation assays: Detecting TNFAIP8L2 protein interactions in situ with high sensitivity

• CODEX multiplexed imaging: Combining TNFAIP8L2 detection with dozens of other markers in single tissue sections