TRERF1 Antibody

What is TRERF1 and why is it significant for transcriptional regulation research?

TRERF1 (Transcriptional-Regulating Factor 1) is a zinc-finger transcriptional regulating protein that interacts with CBP/p300 to regulate the human gene CYP11A1. The significance of TRERF1 stems from its role in transcriptional regulation networks and alternative splicing mechanisms that result in multiple transcript variants encoding different isoforms . As a regulatory protein with multiple synonyms (RAPA, BCAR2, TREP132, TReP-132, HSA277276, dJ139D8.5), TRERF1 represents an important factor in understanding gene expression control mechanisms . Research on TRERF1 contributes to our understanding of transcriptional regulation pathways, with implications for various biological processes including cellular differentiation and disease mechanisms.

To maintain optimal antibody performance and extend shelf life, TRERF1 antibodies require specific storage and handling conditions. Most commercial TRERF1 antibodies are supplied as buffered aqueous glycerol solutions, typically in PBS with 0.02-0.05% sodium azide and 50% glycerol at pH 7.3 .

For long-term storage, aliquot the antibody and store at -20°C to avoid repeated freeze/thaw cycles which can significantly reduce antibody efficacy and increase background signal . The recommended shelf life for most TRERF1 antibody preparations is approximately 12 months from the date of receipt when properly stored . When working with the antibody, briefly centrifuge before opening the tube and maintain on ice during use. For diluted working solutions, prepare only the amount needed for immediate use to maintain stability and specificity.

How do different fixation and antigen retrieval methods affect TRERF1 antibody performance in immunohistochemistry?

Fixation methods and antigen retrieval protocols significantly impact the performance of TRERF1 antibodies in immunohistochemistry applications. For formalin-fixed paraffin-embedded (FFPE) tissue sections, heat-induced epitope retrieval with citrate buffer at pH 6.0 is specifically recommended to optimize antigen recognition . This method effectively reverses protein cross-linking caused by formalin fixation while preserving tissue morphology.

Alternative fixation methods such as alcohol-based fixatives may require different antigen retrieval approaches. When working with frozen sections, fixation with 4% paraformaldehyde followed by permeabilization with 0.1-0.3% Triton X-100 can provide good results while maintaining antigen accessibility.

The duration of fixation also impacts antibody performance. Overfixation can mask epitopes and reduce antibody binding, while underfixation may compromise tissue morphology. For optimal results, researchers should:

• Test multiple antigen retrieval methods if working with differently fixed specimens

• Include positive and negative controls to validate antibody specificity

• Consider using tissue microarrays for efficient optimization of retrieval conditions

• Document fixation parameters to ensure reproducibility

What are the considerations for selecting between polyclonal and monoclonal antibodies against TRERF1?

When designing experiments involving TRERF1, researchers must carefully consider the relative advantages of polyclonal versus monoclonal antibodies. Based on the available research tools, most commercial TRERF1 antibodies are polyclonal preparations raised in rabbits .

Polyclonal TRERF1 antibodies offer several advantages for research applications:

• Recognition of multiple epitopes, providing robust detection even if some epitopes are masked or modified

• Higher sensitivity for proteins expressed at low levels

• Greater tolerance to minor protein denaturation or conformational changes

• Batch-to-batch variability may necessitate validation between lots

• Potential for cross-reactivity with related proteins

• Less specificity for distinguishing between protein isoforms

When selecting an antibody, researchers should consider their specific experimental needs:

• For detection of low abundance TRERF1 in complex samples, polyclonal antibodies may provide greater sensitivity

• For longitudinal studies requiring consistent reagents, testing of batch-to-batch reproducibility is essential

• For isoform-specific detection, antibodies targeting unique regions of specific variants should be selected

Most validated TRERF1 antibodies demonstrate reactivity with both human and mouse TRERF1 proteins , making them suitable for comparative studies across these species.

What controls should be implemented when validating TRERF1 antibody specificity?

Rigorous validation of TRERF1 antibody specificity is essential for generating reliable research data. A comprehensive validation approach should include multiple complementary control strategies:

• Positive tissue/cell controls:

  • Use tissues or cell lines with documented TRERF1 expression

  • Compare staining patterns with published literature and database resources

• Negative controls:

  • Primary antibody omission to assess secondary antibody specificity

  • Isotype controls to identify non-specific binding

  • TRERF1-negative or knockdown samples (if available)

• Peptide competition assays:

  • Pre-incubation of antibody with immunizing peptide should abolish specific signal

  • Commercial TRERF1 antibodies are typically raised against synthetic peptides of human TRERF1

• Orthogonal validation:

  • Correlation with mRNA expression data

  • Comparison of results using antibodies targeting different epitopes

  • Enhanced validation through RNAseq correlation

• Western blot validation:

  • Confirm detection of protein at the expected molecular weight (observed MW: 132 kDa)

  • Assess for additional bands that might indicate cross-reactivity

Implementing these controls systematically helps distinguish specific signal from background and ensures experimental reproducibility. Modern approaches to antibody validation, including orthogonal RNAseq validation as noted for some TRERF1 antibodies , provide additional confidence in antibody specificity.

How can TRERF1 antibodies be employed to investigate protein-protein interactions with CBP/p300?

Investigating the functional interaction between TRERF1 and CBP/p300 requires specialized experimental approaches using validated antibodies. Several methodologies can be employed:

• Co-immunoprecipitation (Co-IP):

  • Use anti-TRERF1 antibodies to pull down protein complexes from cell lysates

  • Analyze precipitated material by western blot with anti-CBP/p300 antibodies

  • Reciprocal Co-IP with CBP/p300 antibodies can confirm interaction

  • Including RNase treatment can distinguish RNA-dependent from direct protein interactions

• Proximity Ligation Assay (PLA):

  • Combines antibody recognition with DNA amplification to visualize protein interactions in situ

  • Requires antibodies raised in different species (e.g., rabbit anti-TRERF1 with mouse anti-CBP/p300)

  • Provides spatial information about interaction sites within cells

  • Quantitative analysis possible through automated image analysis

• Chromatin Immunoprecipitation (ChIP):

  • Use TRERF1 antibodies to immunoprecipitate protein-DNA complexes

  • Sequential ChIP (re-ChIP) with CBP/p300 antibodies can identify co-occupied genomic regions

  • Focus analysis on the CYP11A1 promoter region, a known target of TRERF1 regulation

  • Integration with RNA-seq data can reveal functional consequences of co-occupancy

• Fluorescence Resonance Energy Transfer (FRET):

  • Requires fluorophore-conjugated antibodies or expression of fluorescently-tagged proteins

  • Provides information about the proximity of interacting proteins (<10 nm)

  • Can be performed in fixed or live cells for dynamic interaction studies

When designing these experiments, consideration should be given to the nuclear localization of these interactions and the potential impact of fixation methods on epitope accessibility and protein complex preservation.

What methodological approaches can address inconsistent TRERF1 antibody performance in immunoblotting applications?

Researchers may encounter technical challenges when using TRERF1 antibodies for western blotting. To address inconsistent performance, consider implementing the following methodological refinements:

• Sample preparation optimization:

  • TRERF1 is a large protein (132 kDa) that may be susceptible to proteolytic degradation

  • Use fresh tissue/cell lysates with complete protease inhibitor cocktails

  • Avoid repeated freeze-thaw cycles of samples

  • Consider nuclear extraction protocols to enrich for TRERF1, as it is a nuclear transcription factor

• Transfer optimization for high molecular weight proteins:

  • Use lower percentage SDS-PAGE gels (6-8%) for better resolution of large proteins

  • Implement longer or semi-dry transfer protocols optimized for high molecular weight proteins

  • Consider adding SDS (0.1%) to transfer buffer to improve elution from gel

  • Extend transfer time while maintaining lower current to avoid heat-induced protein precipitation

• Blocking and antibody incubation:

  • Test alternative blocking reagents (BSA vs. milk) as milk may contain phosphatases that affect phospho-epitopes

  • Optimize primary antibody concentration (recommended range: 1:200-1:1000)

  • Extend primary antibody incubation time (overnight at 4°C)

  • Include 0.1% Tween-20 in antibody dilution buffer to reduce background

• Signal development strategies:

  • For low abundance targets, consider using enhanced chemiluminescence substrates

  • Increase exposure time incrementally to capture weak signals

  • For quantitative analysis, consider fluorescently-labeled secondary antibodies and imaging systems

• Epitope accessibility considerations:

  • Some antibodies may recognize epitopes that are masked in the native protein conformation

  • Testing both reducing and non-reducing conditions may reveal differences in epitope accessibility

  • The immunogen sequence used for some TRERF1 antibodies (e.g., PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG) can inform on potential epitope accessibility issues

Implementation of these technical refinements should be systematic, changing one variable at a time to identify the specific factors affecting antibody performance.

How can TRERF1 antibodies be employed to investigate post-translational modifications and their impact on transcriptional regulation?

Investigating post-translational modifications (PTMs) of TRERF1 provides critical insights into its regulatory mechanisms. While standard TRERF1 antibodies recognize the unmodified protein , advanced research approaches can reveal how PTMs influence TRERF1 function:

• Identification of TRERF1 PTM sites:

  • Immunoprecipitate TRERF1 using validated antibodies

  • Analyze by mass spectrometry to identify phosphorylation, acetylation, SUMOylation, or other modifications

  • Compare PTM profiles under different cellular conditions (e.g., hormone stimulation, stress response)

• Generation of PTM-specific antibodies:

  • While commercial PTM-specific TRERF1 antibodies are not widely available, custom antibodies can be generated against predicted or identified PTM sites

  • Validate specificity using peptide competition with modified and unmodified peptides

  • Assess cross-reactivity with related transcription factors

• Functional analysis of PTMs:

  • Combine TRERF1 immunoprecipitation with antibodies against specific PTMs

  • Use chromatin immunoprecipitation (ChIP) to assess how PTMs affect genomic binding patterns

  • Implement proximity ligation assays to visualize how PTMs affect protein-protein interactions in situ

• Temporal dynamics of TRERF1 modifications:

  • Employ time-course experiments with synchronized cells

  • Use standard TRERF1 antibodies in combination with PTM detection methods

  • Correlate modifications with functional outcomes such as target gene expression

• Computational analysis of potential modification sites:

  • The TRERF1 sequence contains numerous potential modification sites

  • Analysis of the immunogen sequence (PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG) reveals potential phosphorylation sites (multiple S/T residues)

  • Bioinformatic prediction tools can guide targeted investigation of high-probability modification sites

When designing PTM studies, researchers should consider that some modifications may mask antibody epitopes, potentially requiring multiple antibodies recognizing different regions of TRERF1 for comprehensive analysis.

What are common causes of non-specific background in TRERF1 immunostaining and how can they be mitigated?

Non-specific background is a common challenge in immunostaining applications that can complicate interpretation of TRERF1 localization. Multiple factors contribute to background signal and require specific mitigation strategies:

• Antibody concentration optimization:

  • Titrate antibody concentration to determine optimal signal-to-noise ratio

  • For TRERF1 antibodies, recommended dilutions for IHC range from 1:50 to 1:200

  • Excessive antibody concentration often increases background without improving specific signal

• Blocking protocol refinement:

  • Extend blocking time (1-2 hours at room temperature)

  • Test alternative blocking reagents (e.g., normal serum from the same species as secondary antibody)

  • For tissues with high endogenous biotin, include avidin/biotin blocking steps

  • Consider dual blocking with both protein blockers and detergent-based reagents

• Endogenous enzyme activity:

  • Quench endogenous peroxidase with H₂O₂ treatment before antibody incubation

  • For alkaline phosphatase detection systems, include levamisole to block endogenous phosphatase

  • Optimize quenching conditions to prevent epitope damage

• Tissue-specific considerations:

  • Certain tissues (liver, kidney) have higher intrinsic background

  • Increase washing steps (frequency and duration) for tissues with high protein content

  • Consider autofluorescence quenching reagents for fluorescence-based detection

• Antibody specificity issues:

  • Validate antibody specificity through peptide competition assays

  • Pre-adsorb antibody with tissue powder from species of interest

  • Include appropriate negative controls (isotype control, antibody omission)

A systematic approach to troubleshooting background involves changing one parameter at a time and documenting results. Implementing these refinements can significantly improve the signal-to-noise ratio in TRERF1 immunostaining applications.

How can researchers validate TRERF1 antibody performance across different experimental systems and species?

Cross-validation of TRERF1 antibodies across experimental systems and species requires a structured approach to ensure consistent and reliable results:

• Species reactivity assessment:

  • Commercial TRERF1 antibodies typically show reactivity with human and mouse TRERF1

  • Sequence alignment analysis between human and target species can predict potential cross-reactivity

  • When working with non-validated species, preliminary western blot validation is essential

• System-specific validation protocols:

  Experimental System	Validation Approach	Considerations
  Cell lines	Western blot with positive and negative control lines	Use TRERF1 knockdown/knockout cells as negative controls
  Tissue sections	IHC on tissue microarrays with known expression patterns	Compare with RNA expression databases (e.g., Human Protein Atlas)
  Primary cells	Comparison with established TRERF1 expression patterns	Account for expression changes during culture
  In vivo models	Species-matched positive controls	Consider fixation effects on epitope preservation

• Cross-platform validation:

  • Confirm protein detection across multiple techniques (WB, IHC, ICC)

  • Use orthogonal approaches (RNA detection, mass spectrometry) to verify protein identification

  • Compare results with enhanced validation methods like orthogonal RNAseq validation

• Epitope conservation analysis:

  • The synthetic peptide immunogens used for antibody production should be compared across species

  • Regions with high sequence conservation are more likely to show cross-reactivity

  • Post-translational modifications may differ between species, affecting epitope recognition

• Documentation and standardization:

  • Maintain detailed records of validation experiments

  • Establish standard operating procedures for each experimental system

  • Document lot-to-lot variability when replacing antibody stocks

This comprehensive validation framework ensures that experimental findings are reproducible and comparable across different research contexts and experimental models.

What strategies can overcome epitope masking in formalin-fixed tissues when using TRERF1 antibodies?

Epitope masking is a significant challenge when detecting TRERF1 in formalin-fixed tissues due to formaldehyde-induced protein cross-linking. Advanced antigen retrieval strategies can effectively overcome these limitations:

• Heat-induced epitope retrieval (HIER) optimization:

  • For TRERF1 antibodies, citrate buffer (pH 6.0) is specifically recommended for FFPE tissues

  • Systematically test multiple retrieval solutions:

    • Citrate buffer (pH 6.0)

    • Tris-EDTA (pH 9.0)

    • Glycine-HCl (pH 3.5)

  • Optimize heating parameters:

    • Pressure cooker (1-3 minutes at pressure)

    • Microwave (10-20 minutes at controlled temperature)

    • Water bath (90-95°C for 20-40 minutes)

• Enzymatic antigen retrieval alternatives:

  • Proteinase K digestion (1-5 minutes at room temperature)

  • Trypsin treatment (0.05-0.1%, 10-30 minutes at 37°C)

  • Pepsin digestion (0.4% in 0.01N HCl, 5-15 minutes)

  • Note: enzymatic methods risk tissue damage and epitope destruction if over-digested

• Combined retrieval approaches:

  • Sequential application of HIER followed by mild enzymatic treatment

  • Lower temperature HIER with extended incubation time

  • Dual buffer systems with pH shift during retrieval process

• Alternative fixation protocols:

  • When planning prospective studies, consider:

    • Reducing fixation time (6-24 hours optimal for many applications)

    • Using alternative fixatives (e.g., zinc-based, alcohol-based)

    • Implementation of PAXgene or other preservation systems that better maintain antigenicity

• Signal amplification systems:

  • When epitope recovery is suboptimal, consider:

    • Tyramide signal amplification

    • Polymer-based detection systems

    • Multi-step biotinylated secondary antibody approaches

For each new tissue type or fixation condition, a systematic optimization matrix should be implemented to identify the ideal combination of retrieval parameters. Document successful protocols thoroughly to ensure reproducibility across experiments.

How can TRERF1 antibodies be used to investigate the role of this protein in breast cancer antiestrogen resistance?

TRERF1 is also known as Breast Cancer Anti-estrogen Resistance 2 (BCAR2) , suggesting a role in antiestrogen resistance mechanisms. Methodological approaches to investigate this function include:

• Expression analysis in breast cancer models:

  • Compare TRERF1 protein levels between antiestrogen-sensitive and resistant cell lines using validated antibodies

  • Analyze clinical breast cancer specimens for correlation between TRERF1 expression and treatment response

  • Implement tissue microarray analysis with TRERF1 antibodies to screen larger patient cohorts

• Functional studies with knockdown/overexpression:

  • Validate knockdown/overexpression efficacy using TRERF1 antibodies

  • Monitor changes in antiestrogen sensitivity after TRERF1 modulation

  • Identify changes in downstream pathways using antibody-based multiplex assays

• Mechanistic investigation of TRERF1-mediated resistance:

  • Use chromatin immunoprecipitation with TRERF1 antibodies to identify genomic targets in resistant models

  • Perform co-immunoprecipitation to identify differential protein interactions in resistant vs. sensitive cells

  • Investigate post-translational modifications using specialized antibodies or mass spectrometry after immunoprecipitation

• Therapeutic targeting assessment:

  • Use TRERF1 antibodies to monitor protein levels after experimental interventions

  • Assess cellular localization changes in response to antiestrogen treatment

  • Implement proximity ligation assays to analyze protein interaction dynamics during treatment

• Correlation with established resistance markers:

  • Perform multi-label immunofluorescence with TRERF1 antibodies alongside established markers

  • Analyze co-expression patterns in tissue sections using digital pathology approaches

  • Integrate protein expression data with transcriptomic and clinical outcome data

These methodological approaches provide a framework for comprehensive investigation of TRERF1's role in antiestrogen resistance, potentially identifying new therapeutic targets or resistance biomarkers.

What techniques can be employed to investigate TRERF1's role in regulating CYP11A1 and steroidogenic pathways?

TRERF1 interacts with CBP/p300 to regulate the human gene CYP11A1 , which encodes the cholesterol side-chain cleavage enzyme critical for steroidogenesis. Advanced research techniques to investigate this regulatory function include:

• Chromatin dynamics and transcriptional regulation:

  • Chromatin immunoprecipitation (ChIP) with TRERF1 antibodies to analyze binding to the CYP11A1 promoter

  • ChIP-sequencing to identify genome-wide binding patterns and potential regulatory networks

  • Implementation of CUT&RUN or CUT&Tag for higher resolution binding profiles

  • Sequential ChIP (re-ChIP) to investigate co-occupancy with CBP/p300 at specific genomic loci

• Protein-protein interaction networks:

  • Co-immunoprecipitation with TRERF1 antibodies followed by mass spectrometry to identify interaction partners

  • Proximity-dependent biotin identification (BioID) using TRERF1 fusion proteins

  • FRET-based assays to investigate dynamic interactions in living cells

  • Mammalian two-hybrid assays to map interaction domains

• Functional assessment in steroidogenic cell models:

  • siRNA knockdown of TRERF1 followed by western blot analysis of CYP11A1 protein levels

  • Luciferase reporter assays with CYP11A1 promoter constructs to assess transcriptional activation

  • Measurement of steroid hormone production after TRERF1 modulation

  • Analysis of CYP11A1 enzymatic activity in correlation with TRERF1 expression levels

• In vivo models and tissue analysis:

  • Immunohistochemical co-localization of TRERF1 and CYP11A1 in steroidogenic tissues

  • Analysis of tissue-specific expression patterns using validated antibodies

  • Correlation of expression levels with steroidogenic activity in normal and pathological tissue samples

  • Implementation of conditional knockout models with validation using TRERF1 antibodies

• Integration with systems biology approaches:

  • Correlation of TRERF1 binding patterns with gene expression data

  • Network analysis of transcription factors co-regulating steroidogenic genes

  • Pathway enrichment analysis of genes co-regulated with CYP11A1

These methodological approaches provide a comprehensive framework for investigating the molecular mechanisms by which TRERF1 regulates CYP11A1 and influences steroidogenic pathways.