trio Antibody

Shipped with Ice Packs
In Stock

Description

Trio Protein Overview

Trio (Triple functional domain protein) is a large multidomain protein with three catalytic domains: two Rho-GEF domains (GEF1 and GEF2) and a serine/threonine kinase domain. It regulates Rac1, RhoG, and RhoA GTPases, influencing processes like neural crest cell (NCC) migration, synaptic function, and cancer progression .

DomainFunctionAssociated Pathways
GEF1 (N-terminal)Activates Rac1/RhoG, driving actin polymerizationNeural crest migration, axon guidance
GEF2 (C-terminal)Activates RhoA, modulating stress fiber formationOsteogenic differentiation, cancer
Kinase domainPhosphorylates downstream targetsSignal transduction, cell adhesion

Key Antibody Clones and Applications

Trio antibodies are widely used in research for techniques such as immunofluorescence (IF), Western blot (WB), and immunohistochemistry (IHC). Notable clones include:

Clone 9.4A (DSHB)

  • Host Species: Mouse

  • Isotype: IgG1

  • Applications:

    • Immunofluorescence (IF): 2–5 µg/ml

    • Western blot (WB): 0.2–0.5 µg/ml

  • Epitope: Amino acids 1697–1925 of Drosophila Trio isoform A .

  • Specificity: Recognizes isoforms A/D; cross-reactivity with B/E possible .

Anti-TRIO (Sigma-Aldrich HPA008157)

  • Host Species: Rabbit

  • Applications:

    • Immunohistochemistry (IHC): 1:20–1:50 dilution .

  • Immunogen Sequence: MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN .

Role in Neural Crest Development

  • Knockdown Studies: Zebrafish trio morphants exhibited craniofacial defects, including retracted mandibles and reduced Meckel’s cartilage, due to impaired NCC migration .

  • Mechanism: Trio interacts with Myh9 (non-muscle myosin IIA) to stabilize actin filaments and microtubules, enabling NCC polarization .

    • Key Data: Trio-deficient NCCs showed 40% reduced migration in Transwell assays .

Cancer Implications

  • Osteosarcoma (OS): Trio overexpression correlates with poor prognosis. Silencing Trio in OS cell lines (U2OS, 143B) reduced proliferation by 50% and invasion by 60% .

  • Signaling Pathways: Trio activates MAPK/ERK and p38 pathways, promoting epithelial-mesenchymal transition (EMT) via Snail upregulation .

Neuronal Function

  • Synaptic Regulation: Trio knockdown in hippocampal neurons reduced AMPA receptor (AMPAr) endocytosis by 30%, impairing synaptic plasticity .

  • Axon Guidance: Trio-deficient neurons exhibited disrupted Ankyrin G localization, affecting axon initial segment formation .

Cross-Reactivity

SpeciesReactivityValidated Applications
HumanYesIHC, IF, WB
MouseYesIF, IHC
ZebrafishYesMorpholino knockdown studies

Clinical and Therapeutic Relevance

  • Craniofacial Disorders: TRIO mutations are linked to microcephaly and mandibular retrusion .

  • Cancer Immunotherapy: Bispecific Trio-engaging antibodies (e.g., Triomab®) target tumor antigens (e.g., EpCAM, CD20) and CD3 on T cells, enhancing antitumor responses .

    • Example: Catumaxomab (anti-EpCAM × anti-CD3) showed trifunctional binding to tumor cells, T cells, and Fcγ receptors .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
trio antibody; si:dkey-158b13.2 antibody; Triple functional domain protein antibody; EC 2.7.11.1 antibody
Target Names
trio
Uniprot No.

Target Background

Function
This antibody promotes the exchange of GDP by GTP. In conjunction with leukocyte antigen-related (LAR) protein, it may play a crucial role in coordinating cell-matrix and cytoskeletal rearrangements essential for cell migration and growth.
Database Links
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Subcellular Location
Cytoplasm.

Q&A

What is TRIO protein and why is it significant in research?

TRIO is a 346.9 kDa triple functional domain protein that functions as a Rho guanine nucleotide exchange factor (GEF) . It has significant roles in neuronal development, particularly limiting dendrite formation in developing hippocampal neurons and regulating endocytosis of AMPA-selective glutamate receptors in CA1 excitatory synapses . TRIO has gained research attention due to its involvement in cancer progression, including osteosarcoma, where it promotes proliferation, migration, and invasion while inhibiting osteogenic differentiation . The multifunctional nature of TRIO, with its separate Rac-specific and Rho-specific guanine nucleotide exchange factor domains, makes it a complex but important research target .

What types of TRIO antibodies are available for research and how do they differ?

Several types of TRIO antibodies are commercially available with different applications and specifications:

Antibody TypeApplicationsReactivityFormat
PolyclonalWB, ELISAHuman, Mouse, RatUnconjugated
Affinity PurifiedWB, IPHumanUnconjugated
C-terminal regionWestern BlotHuman, Mouse, Rabbit, Rat, etc.Various
RecombinantVariousHumanVarious

TRIO antibodies can target different epitopes of the protein, with some specifically designed for the C-terminal region . The selection of the appropriate antibody depends on the specific experimental needs, including the detection method, species being studied, and the specific domain of TRIO under investigation.

How does the structure of TRIO protein influence antibody selection for research?

TRIO is a multidomain protein containing two GEF domains that regulate RhoGTPases . When selecting antibodies, researchers should consider which functional domain they wish to study. The protein's large size (346.9 kDa) may present challenges for certain applications, particularly for Western blotting where specific protocols might be needed (such as using 6% SDS-PAGE gel as mentioned in research protocols) . Additionally, TRIO's subcellular localization in the cytoplasm and cell projections means that antibodies intended for immunocytochemistry should be validated for these specific compartments. The complex structure of TRIO may also lead to potential cross-reactivity issues, making rigorous validation critical when selecting antibodies for specific experimental applications.

What are the optimal protocols for using TRIO antibodies in Western blotting?

For optimal Western blotting with TRIO antibodies, researchers should consider:

  • Sample preparation: Complete protein extraction with protease inhibitors to prevent degradation of the large TRIO protein.

  • Gel preparation: Use 6% SDS-PAGE gels specifically for TRIO detection due to its high molecular weight (346.9 kDa) .

  • Transfer conditions: Extended transfer times (often overnight at low voltage) on ice to ensure complete transfer of large proteins.

  • Blocking: 5% defatted milk or 5% BSA for phosphorylated protein detection for 2 hours at room temperature .

  • Primary antibody incubation: Overnight at 4°C with optimized dilution (typically 1:1000 to 1:2000 based on antibody specifications) .

  • Washing: Three washes with TBST after primary and secondary antibody incubations .

  • Detection: ECL chemiluminescence system with extended exposure times may be necessary for the large TRIO protein .

  • Quantification: Use ImageJ v.1.52 or similar software for quantitative analysis .

When performing experiments with TRIO antibodies, it's essential to run appropriate controls, including positive control tissues known to express TRIO (such as heart, skeletal muscle, and brain tissues where TRIO is highly expressed) .

How can I validate the specificity of TRIO antibodies for my experimental system?

Validating TRIO antibody specificity requires multiple complementary approaches:

  • Positive and negative tissue controls: Test antibodies on tissues known to express TRIO positively (heart, skeletal muscle, and brain) and negatively .

  • Knockdown/knockout validation: Compare antibody staining between wild-type samples and those where TRIO expression has been reduced via siRNA, shRNA, or CRISPR-Cas9.

  • Peptide competition assay: Pre-incubate the antibody with the immunizing peptide to confirm signal reduction.

  • Multiple antibody comparison: Use antibodies from different sources or targeting different epitopes to confirm consistent staining patterns.

  • Orthogonal methods: Validate protein expression using alternative methods like mass spectrometry or RNA expression analysis.

  • Species cross-reactivity testing: If working across species, test specificity in each relevant organism as the antibody may perform differently .

Flow cytometry has been demonstrated as a robust method for evaluating antibody binding to native surface antigens in viable cells, which more closely resembles the in vivo situation compared to ELISA or Biacore methods that depend on recombinant antigen quality .

What are the key considerations for using TRIO antibodies in immunohistochemistry (IHC)?

When using TRIO antibodies for IHC, researchers should consider:

  • Fixation and antigen retrieval: TRIO is a large protein that may require optimized antigen retrieval methods. Test both citrate buffer (pH 6.0) and EDTA buffer (pH 9.0) at various time points.

  • Antibody concentration optimization: Titrate antibodies to determine optimal concentration that maximizes specific staining while minimizing background.

  • Incubation conditions: Longer primary antibody incubation times (overnight at 4°C) may improve detection of TRIO.

  • Detection systems: Consider signal amplification systems for detecting potentially low-abundance TRIO protein.

  • Controls: Include positive controls (tissues with known TRIO expression like heart or brain) , negative controls (tissues without TRIO expression), and technical controls (primary antibody omission).

  • Subcellular localization: TRIO localizes to the cytoplasm and cell projections , so proper interpretation of staining patterns should account for this distribution pattern.

  • Quantification: For quantitative IHC, establish consistent scoring systems and use digital image analysis software to reduce subjective interpretation.

  • Dual staining: Consider co-staining for known TRIO-interacting proteins or pathway components to validate functional relevance of staining patterns.

How can I investigate the role of TRIO in cancer progression using antibodies?

To investigate TRIO's role in cancer progression, researchers can employ multiple antibody-based approaches:

  • Expression profiling: Use TRIO antibodies to compare expression levels between normal and cancerous tissues via IHC, Western blotting, or tissue microarrays. This has revealed TRIO's high expression in osteosarcoma compared to normal tissues .

  • Functional assays with antibody validation:

    • Proliferation assays (following confirmation of TRIO expression or knockdown)

    • Migration/invasion assays (Transwell or wound healing)

    • Osteogenic differentiation assays (as TRIO inhibits osteogenic differentiation in osteosarcoma)

  • Signaling pathway analysis: Investigate TRIO's role in RhoGTPase activation by using antibodies against TRIO along with antibodies for downstream signaling molecules (p38, JNK, ERK) and their phosphorylated forms .

  • EMT marker correlation: Examine correlations between TRIO expression and epithelial-mesenchymal transition markers (E-Cadherin, N-Cadherin, Vimentin, Snail) using corresponding antibodies in parallel .

  • In vivo models: Use TRIO antibodies to confirm expression in xenograft models when studying tumor growth, potentially employing IHC to assess TRIO expression in different tumor regions .

Research has demonstrated that TRIO promotes proliferation, migration, and invasion of osteosarcoma cells while inhibiting their osteogenic differentiation, suggesting it could serve as a potential target and prognostic marker for osteosarcoma .

What is the difference between anti-TRIO antibodies and trifunctional antibodies in research applications?

This is an important distinction that often causes confusion:

Anti-TRIO Antibodies:

  • These are antibodies that specifically bind to and detect the TRIO protein (triple functional domain protein/Rho guanine nucleotide exchange factor)

  • Used primarily as research tools for detecting, quantifying, or immunoprecipitating TRIO protein

  • Applications include Western blotting, immunohistochemistry, ELISA, and immunoprecipitation

  • Available in various formats including polyclonal, monoclonal, and recombinant antibodies

Trifunctional Antibodies (Triomab®):

  • These are engineered therapeutic antibodies with three functional binding sites

  • Consist of two different full-size IgG-like half antibodies (mouse IgG2a and rat IgG2b isotypes)

  • Can simultaneously bind to:

    • Tumor-associated antigens

    • CD3 molecule on T-cells

    • Fcγ-receptors on accessory cells

  • Examples include catumaxomab (targeting EpCAM), ertumaxomab (targeting HER2/neu), and FBTA05 (targeting CD20)

  • Primarily developed as cancer therapeutics, not research reagents

The terminology confusion arises because both contain "trio" in their names but refer to entirely different molecules with distinct applications in research and clinical settings.

How can I design experiments to study TRIO's role in neuronal development?

To study TRIO's role in neuronal development, consider these antibody-based experimental approaches:

  • Developmental expression profiling:

    • Use Western blotting with anti-TRIO antibodies to track expression across developmental stages

    • Perform IHC on brain sections from different developmental timepoints

    • Compare TRIO expression in different neuronal subtypes using co-immunostaining

  • Subcellular localization studies:

    • Use immunocytochemistry with TRIO antibodies to visualize localization in developing neurons

    • Focus on dendrites and synapses where TRIO is known to function

    • Perform co-localization studies with markers for subcellular compartments

  • TRIO knockdown/overexpression effects:

    • Transfect neurons with TRIO shRNA or overexpression constructs

    • Use TRIO antibodies to confirm knockdown/overexpression efficiency

    • Quantify dendritic morphology (as TRIO limits dendrite formation)

    • Measure synaptic parameters including spine density and morphology

  • AMPAR endocytosis assays:

    • Given TRIO's role in regulating AMPAR endocytosis , design antibody-based internalization assays

    • Use surface biotinylation and TRIO antibodies to track receptor trafficking

  • RhoGTPase activation:

    • Perform pull-down assays for active Rac/Rho combined with TRIO immunoprecipitation

    • Use phospho-specific antibodies to downstream effectors to confirm pathway activation

Remember to include appropriate controls for antibody specificity and experimental manipulations, particularly given the complexity of neuronal cultures and developmental systems.

How do I address potential cross-reactivity issues when using TRIO antibodies in my research?

Addressing cross-reactivity with TRIO antibodies requires a systematic approach:

  • Epitope analysis: Review the immunogen sequence used to generate the antibody and check for homology with other proteins using bioinformatics tools like BLAST.

  • Multiple antibody validation: Use at least two different antibodies targeting distinct epitopes of TRIO to confirm consistent results .

  • Knockout/knockdown controls: Include TRIO knockdown or knockout samples as negative controls to confirm signal specificity.

  • Pre-absorption controls: Pre-incubate antibody with immunizing peptide to demonstrate signal reduction.

  • Western blot assessment: Confirm the antibody detects a single band at the expected molecular weight (346.9 kDa) for TRIO . Be aware that TRIO requires special conditions (6% SDS-PAGE) .

  • Species considerations: Verify antibody performance in your specific species of interest, as reactivity can vary significantly between species .

  • Batch testing: Test new antibody lots against previous lots to ensure consistent performance.

  • Positive control selection: Use tissues known to express high levels of TRIO (heart, skeletal muscle, brain) as positive controls.

Remember that antibodies targeting closely related proteins in the ARHGEF family may cross-react with TRIO due to structural similarities in their GEF domains. When possible, use orthogonal methods to confirm your findings.

What are common pitfalls and solutions when detecting TRIO protein in Western blotting?

PitfallCauseSolution
No signal or weak signalLarge protein size (346.9 kDa) limiting transfer efficiencyUse 6% SDS-PAGE gels specifically for TRIO ; perform longer transfer times at lower voltage; consider wet transfer systems
Multiple bandsDegradation or isoformsUse fresh samples with protease inhibitors; verify against known TRIO molecular weight; check literature for potential isoforms
High backgroundNon-specific bindingOptimize blocking (try both milk and BSA); increase washing steps; dilute antibody further; try different antibody
Inconsistent results between experimentsAntibody quality variationUse same lot of antibody when possible; include positive controls in each experiment; standardize protocols
Signal at incorrect molecular weightCross-reactivity or degradationVerify with another TRIO antibody targeting different epitope; include positive control sample

Additional methodological considerations:

  • TRIO's large size requires special care during sample preparation to prevent degradation

  • Extend transfer time for complete transfer of high molecular weight proteins

  • Use appropriate positive controls, such as heart or brain tissue lysates, which naturally express high levels of TRIO

  • Consider using gradient gels for better resolution of high molecular weight proteins

How can I use TRIO antibodies to investigate interactions between TRIO and other signaling molecules?

To investigate TRIO's interactions with other signaling molecules:

  • Co-immunoprecipitation (Co-IP):

    • Immunoprecipitate TRIO using validated anti-TRIO antibodies

    • Perform Western blotting for suspected interaction partners

    • Confirm specificity with reverse Co-IP (immunoprecipitate the partner and blot for TRIO)

    • Include appropriate controls (IgG control, input samples)

  • Proximity Ligation Assay (PLA):

    • Use TRIO antibody together with antibody against suspected interaction partner

    • PLA signals visualize protein interactions at single-molecule resolution in situ

    • Quantify interaction signals in different cellular contexts or treatments

  • Immunofluorescence co-localization:

    • Perform double immunostaining with TRIO antibody and antibodies against:

      • RhoGTPases (as TRIO regulates these)

      • Signaling molecules such as p38, JNK, ERK and their phosphorylated forms

      • Other relevant proteins (PTPRF, as TRIO is a PTPRF-interacting protein)

    • Quantify co-localization using appropriate statistical methods

  • Pull-down assays:

    • Use recombinant TRIO domains to pull down interaction partners

    • Confirm interactions by Western blotting with specific antibodies

  • Analysis of phosphorylation status:

    • Immunoprecipitate TRIO and blot with phospho-specific antibodies

    • Check how TRIO affects phosphorylation of downstream targets by comparing phospho-specific antibody signals in TRIO-manipulated vs. control cells

Research has demonstrated that TRIO regulates osteosarcoma progression and osteogenic differentiation through RhoGTPase activation, suggesting potential signaling networks to investigate .

How are TRIO antibodies being used to explore potential therapeutic applications?

TRIO antibodies are facilitating several therapeutic research directions:

  • Cancer therapy development:

    • TRIO has been identified as promoting cancer progression in osteosarcoma

    • Researchers use TRIO antibodies to validate expression in patient samples and assess correlation with clinical outcomes

    • Antibodies help evaluate the effects of potential TRIO inhibitors on cancer cell lines

    • TRIO's role in promoting proliferation, migration, and invasion of cancer cells makes it a potential therapeutic target

  • Neurodevelopmental disorder investigations:

    • TRIO's function in dendritic formation and synaptic regulation suggests relevance to neurodevelopmental conditions

    • Antibodies enable expression profiling in neurological disease models

    • Researchers can use TRIO antibodies to assess effects of potential neurological therapeutics on TRIO expression and localization

  • Target validation studies:

    • Antibodies help confirm TRIO expression in relevant tissues before developing targeted therapeutics

    • Immunohistochemistry with TRIO antibodies on patient samples helps identify suitable patient populations for potential TRIO-targeted therapies

  • Distinguishing from trifunctional antibody therapeutics:

    • While anti-TRIO antibodies are research tools, the trifunctional antibody platform (Triomab®) represents a separate therapeutic approach

    • Trifunctional antibodies like catumaxomab target tumor-associated antigens, CD3 on T-cells, and Fcγ receptors on accessory cells simultaneously

    • Understanding the distinction is crucial when reviewing literature on "trio antibodies"

As research continues to elucidate TRIO's role in various diseases, antibodies remain essential tools for validating this protein as a therapeutic target and developing effective interventions.

What new methodologies are emerging for studying TRIO using antibody-based approaches?

Several innovative antibody-based approaches are advancing TRIO research:

  • Super-resolution microscopy techniques:

    • Combining highly specific TRIO antibodies with techniques like STORM or PALM

    • Enables visualization of TRIO's subcellular localization at nanometer resolution

    • Particularly valuable for studying TRIO in neuronal structures like dendritic spines and synapses

  • Multiplexed immunoassays:

    • Simultaneous detection of TRIO alongside multiple signaling molecules

    • Using technologies like Nanostring, CyTOF, or multiplexed immunofluorescence

    • Allows comprehensive pathway analysis in limited sample material

  • Antibody-based biosensors:

    • Development of FRET-based biosensors incorporating TRIO antibody fragments

    • Enables real-time monitoring of TRIO conformational changes or interactions

    • Useful for studying dynamic regulation of TRIO activity

  • Single-cell antibody-based proteomics:

    • Applying TRIO antibodies in single-cell Western blot or similar technologies

    • Reveals cell-to-cell heterogeneity in TRIO expression and signaling

  • Spatially-resolved transcriptomics combined with TRIO immunostaining:

    • Correlating TRIO protein localization with local transcriptional profiles

    • Provides insights into TRIO's context-specific functions

  • CRISPR-engineered cell lines expressing tagged TRIO:

    • Creating endogenous tags to validate antibody specificity

    • Enables more reliable antibody-based detection without overexpression artifacts

These emerging methods extend beyond traditional applications like Western blotting and immunohistochemistry, providing researchers with more sophisticated tools to understand TRIO's complex biology in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.