TRMT11 (tRNA methyltransferase 11 homolog) antibodies are polyclonal reagents primarily used to identify and quantify the TRMT11 protein in experimental settings. TRMT11 functions as a catalytic subunit in a methyltransferase complex that modifies guanosine at position 10 (m²G10) in tRNAs, critical for RNA stability and translation fidelity . Antibodies targeting TRMT11 enable researchers to investigate its expression, localization, and interactions in cellular processes.
TRMT11 operates within a network of methyltransferases (MTases) regulated by the co-factor TRMT112. Studies using SILAC (stable isotope labeling by amino acids in cell culture) identified TRMT11 as a novel interactor of TRMT112, alongside established partners like WBSCR22 and METTL5 . This interaction suggests TRMT11’s involvement in tRNA methylation and potential cross-talk with other RNA-modifying enzymes.
Overexpressed TRMT11: Co-localizes with TRMT112 in the cytoplasm, influencing its distribution .
Functional Impact: TRMT112 overexpression reduces endogenous TRMT112 levels but does not significantly alter TRMT11 or other MTase levels, indicating tight regulatory control .
Disease Associations: TRMT11 dysregulation is implicated in myelodysplastic syndromes (MDS) and cancer .
Mechanistic Studies: Antibodies enable exploration of TRMT11’s role in tRNA modification and its impact on cellular stress responses .
Technical Considerations: Antibody specificity is confirmed via peptide-blocking assays and siRNA knockdowns in validation studies .
KEGG: sce:YOL124C
STRING: 4932.YOL124C
TRM11 (also known as TRMT11) is a tRNA methyltransferase 11 homolog that functions as the catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex. It specifically mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs . This enzyme plays a crucial role in post-transcriptional modification of tRNA molecules, which can affect various aspects of translation and protein synthesis. The gene has several synonyms in the literature, including C6orf75, MDS024, and TRMT11-1, with the protein having a predicted size of approximately 53 kDa .
Current research primarily utilizes polyclonal antibodies against TRM11. The most commonly documented are rabbit polyclonal antibodies that demonstrate reactivity against human and mouse TRM11 proteins . These antibodies are typically supplied in a liquid formulation consisting of 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose for stability . While the search results do not explicitly mention monoclonal antibodies against TRM11, the principles of high-affinity monoclonal antibody validation described in other research could potentially be applied to TRM11 studies in the future .
The primary validated application for TRM11 polyclonal antibodies is Western Blot (WB) analysis . This technique allows researchers to detect and quantify TRM11 protein expression in various tissue or cell samples. When using these antibodies for Western blot applications, proper dilution optimization should be performed to ensure specific binding and minimal background. While the search results do not specify exact dilution recommendations, researchers should follow manufacturer guidelines for initial dilutions and then optimize based on their specific experimental conditions and sample types.
The immunogen for anti-TRMT11 antibody production is a synthetic peptide directed towards the N-terminal region of human TRMT11. Specifically, the sequence used is: "IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP" . This peptide sequence shows 100% homology across multiple species including dog, pig, rat, horse, human, mouse, bovine, rabbit, and guinea pig . This high sequence conservation explains the cross-reactivity of the antibody across different mammalian species and makes it versatile for comparative studies.
Validating antibody specificity is critical for ensuring reliable research results. For TRM11 antibodies, consider these methodological approaches:
Positive and negative controls: Include tissues or cell lines known to express or not express TRM11.
Knockdown validation: Perform siRNA-mediated knockdown of TRM11 and confirm reduced antibody signal.
Overexpression validation: Express recombinant TRM11 with a tag (e.g., His or FLAG) and confirm co-localization with the antibody signal.
Peptide competition: Pre-incubate the antibody with the immunizing peptide to block specific binding sites.
Cross-species validation: Given the high sequence homology, confirm similar banding patterns across species if working with comparative models.
This multi-approach validation strategy helps ensure that observed signals are specific to TRM11 rather than non-specific binding or cross-reactivity with related proteins.
While not specifically described for TRM11 antibodies in the provided sources, Time-Resolved Fluorescence Resonance Energy Transfer (TR-FRET) techniques can be adapted to study TRM11 antibody binding characteristics:
Experimental design: Establish a 384-well plate assay using a donor fluorophore (e.g., terbium-cryptate) attached to recombinant TRM11 protein and an acceptor fluorophore (e.g., Alexafluor-488) conjugated to anti-TRM11 Fab fragments .
Concentration optimization: Determine the optimal concentration regime for TRM11 protein, starting with low concentrations (250 pM-4 nM) to avoid the hook effect that may alter apparent rate constants due to antigen excess .
Competition assay setup: For measuring binding affinities, use unlabeled antibodies as competitors against labeled Fab fragments to generate dose-response curves .
Equilibration time: Allow sufficient incubation time (e.g., 18 hours at 4°C) for high-affinity interactions to reach equilibrium .
Data analysis: Fit normalized dose-response curves to analytical equations for binary complexes to determine rate constants and binding affinities .
This approach would enable precise characterization of TRM11 antibody binding properties, including affinity constants and epitope competition.
For successful immunoprecipitation (IP) of TRM11 and associated complexes:
Buffer optimization: Since TRM11 functions in a methyltransferase complex, use buffers that preserve protein-protein interactions (e.g., low-stringency buffers with 150 mM NaCl, 0.5% NP-40).
Pre-clearing: Implement thorough pre-clearing steps to reduce non-specific binding, especially critical with polyclonal antibodies.
Antibody binding strategy: Consider either direct antibody conjugation to beads or using protein A/G beads, with the latter providing higher capacity for rabbit IgG antibodies.
Cross-linking consideration: For studying stable complexes, consider mild formaldehyde cross-linking to preserve transient interactions of the methyltransferase complex.
Elution conditions: Use either acidic conditions (pH 2.5-3.0) or the specific immunizing peptide for gentle elution that preserves activity.
Validation of pull-down: Confirm successful IP using Western blot against TRM11 and potential interacting partners like other components of the methyltransferase complex.
These methodological considerations are important for capturing physiologically relevant TRM11-containing complexes rather than artifacts.
To maintain antibody activity and specificity over time:
Storage temperature: Store TRM11 antibodies at -20°C as received to maintain long-term stability .
Aliquoting: Upon receipt, create small working aliquots to avoid repeated freeze-thaw cycles, which can lead to antibody degradation and loss of activity.
Thawing protocol: Thaw antibodies on ice or at 4°C rather than at room temperature to minimize degradation.
Working dilutions: Prepare working dilutions immediately before use; do not store diluted antibodies for extended periods.
Stability period: TRM11 antibodies are reported to be stable for 12 months from the date of receipt when stored properly .
Sodium azide consideration: Note that the buffer contains 0.09% sodium azide as a preservative , which can inhibit HRP activity if directly used in certain detection systems.
Proper storage and handling significantly impact experimental reproducibility and extend the useful life of the antibody.
For detailed characterization of TRM11 antibody binding kinetics:
Surface Plasmon Resonance (SPR): Immobilize purified TRM11 protein on a sensor chip and flow antibody at different concentrations to measure association (ka) and dissociation (kd) rate constants.
Bio-Layer Interferometry (BLI): Similar to SPR but uses optical interference patterns to measure binding; suitable for real-time kinetic analysis without microfluidics.
Isothermal Titration Calorimetry (ITC): Measures heat changes during binding to determine thermodynamic parameters alongside kinetic data.
TR-FRET competition assays: As described in result , use competitive displacement to determine inhibition constants (KI) which relate to binding affinity.
Data analysis considerations: For high-affinity antibodies, ensure sufficient measurement time to capture slow dissociation phases, and use appropriate mathematical models that account for bivalent binding.
| Method | Primary Data | Advantages | Limitations |
|---|---|---|---|
| SPR | ka, kd, KD | Real-time, label-free | Requires specialized equipment |
| BLI | ka, kd, KD | No microfluidics, easy setup | Lower throughput than SPR |
| ITC | KD, ΔH, ΔS | Complete thermodynamic profile | Requires large sample amounts |
| TR-FRET | KI | High-throughput, solution-phase | Requires fluorescent labeling |
When encountering non-specific binding with TRM11 antibodies:
Blocking optimization: Test different blocking agents (BSA, milk, commercial blockers) to identify the most effective option for your specific sample type.
Antibody dilution: Titrate the antibody concentration to find the optimal signal-to-noise ratio; excessive antibody can increase non-specific binding.
Washing stringency: Adjust salt concentration (150-500 mM NaCl) and detergent type/concentration (0.05-0.1% Tween-20, Triton X-100) in wash buffers.
Sample preparation: Ensure thorough cell lysis and consider pre-clearing lysates with protein A/G beads before antibody incubation.
Cross-adsorption: If cross-reactivity with related proteins is suspected, consider pre-adsorbing the antibody with recombinant proteins of similar sequence.
Alternative detection methods: Compare chemiluminescence, fluorescence, and chromogenic detection systems to identify the method with lowest background.
Systematic optimization of these parameters can significantly improve specificity and reduce background in TRM11 antibody applications.
TRM11 belongs to a larger family of tRNA modification enzymes but has distinct characteristics:
Substrate specificity: TRM11 specifically mediates the methylation of guanosine at position 10 (m2G10) in tRNAs, while other methyltransferases target different positions or nucleotides .
Complex formation: TRM11 functions as part of a methyltransferase complex rather than as a standalone enzyme, suggesting cooperative activity with other proteins .
Evolutionary conservation: The high sequence homology across species (100% in the immunogen region) suggests strong evolutionary conservation of TRM11 function .
Methylation mechanism: Like THUMPD3-TRMT112 (another m2G methyltransferase mentioned in result ), TRM11 likely uses S-adenosyl-L-methionine as a methyl donor for its catalytic activity .
Regulatory pathways: TRM11 has been associated with specific protein pathways including androgen and estrogen metabolism, histidine metabolism, selenoamino acid metabolism, and tyrosine metabolism .
This context helps researchers interpret TRM11 antibody findings within the broader landscape of tRNA modification biology.
Contemporary approaches for tissue-specific TRM11 expression analysis include:
Multiplexed immunohistochemistry: Combining TRM11 antibody staining with markers for specific cell types to identify expression patterns within heterogeneous tissues.
Single-cell western blot: For quantifying TRM11 expression variability at the single-cell level rather than bulk tissue measurements.
Quantum Dot-labeled Lateral Flow Immunoassay (QD-labeled LFIA): This rapid and sensitive detection method (described in result for other applications) could be adapted for TRM11 detection in tissue extracts.
Spatial transcriptomics: Correlating TRM11 protein expression (via antibody staining) with mRNA expression patterns in tissue sections.
Tissue microarrays: High-throughput screening of TRM11 expression across multiple tissue types simultaneously.
These methodologies provide complementary approaches to understanding tissue-specific expression and potential functional variations of TRM11 across different biological contexts.
Investigation of TRM11 using specific antibodies opens several avenues for understanding post-transcriptional regulation:
Temporal dynamics: Tracking TRM11 expression changes during development or in response to cellular stress could reveal regulatory mechanisms governing tRNA modification.
Subcellular localization: Immunofluorescence studies using TRM11 antibodies can identify where in the cell TRM11-mediated methylation occurs and how this localization might be regulated.
Interaction networks: Immunoprecipitation with TRM11 antibodies followed by mass spectrometry can identify novel protein partners that might regulate or be regulated by TRM11 activity.
Modification stoichiometry: Combining TRM11 antibodies with antibodies against modified tRNAs could help determine the relationship between enzyme abundance and modification levels.
Disease relevance: Changes in TRM11 expression in disease states might indicate roles in pathogenesis, potentially linking tRNA modification to disease mechanisms.
These approaches could significantly expand our understanding of how tRNA modifications contribute to translational regulation and cellular function.
When applying TRM11 antibodies across different species:
Epitope conservation analysis: Perform computational alignment of the immunogen sequence across target species to predict cross-reactivity potential.
Western blot validation: Test the antibody against lysates from multiple species, looking for bands of the expected molecular weight (~53 kDa) .
Immunoprecipitation-mass spectrometry: Confirm that proteins pulled down from different species are indeed TRM11 orthologs through peptide sequencing.
Recombinant protein controls: Express TRM11 from different species as tagged proteins to serve as positive controls for antibody validation.
Competitive binding assays: Use TR-FRET or similar techniques to quantitatively compare antibody affinity across orthologs from different species.
The high sequence homology reported for the immunogen region (100% across multiple mammalian species) suggests that current TRM11 antibodies should perform well across evolutionary diverse mammalian models.