TTC23 Antibody

What Applications Are Most Effective for TTC23 Antibody Detection?

TTC23 antibodies can be utilized in multiple experimental applications, with varying levels of validation across different research techniques. Western blotting consistently shows the highest validation rates across multiple antibody products, followed by immunohistochemistry and immunofluorescence techniques.

For optimal results, researchers should begin with the manufacturer's recommended dilutions and optimize based on their specific experimental conditions. Western blotting typically provides the most reliable detection of TTC23, with verified samples including mouse adrenal gland and human liver cancer tissues .

How Should Researchers Validate the Specificity of a TTC23 Antibody?

Antibody validation is critical for ensuring experimental reliability. For TTC23 antibodies, multiple complementary approaches are recommended:

Tissue-Based Validation:

• Use verified positive control tissues: mouse adrenal gland for WB and human liver cancer for IHC

• Include negative control tissues with low/no TTC23 expression

Molecular Validation:

• Confirm detection at the expected molecular weight (50 kDa)

• Perform knockdown/knockout experiments if possible

• Use blocking peptides to confirm specificity of signal

Multi-Antibody Approach:

• Compare antibodies targeting different epitopes (N-terminal versus C-terminal)

• Compare polyclonal and monoclonal antibodies when available

The blocking peptide method is particularly valuable for distinguishing specific from non-specific binding. This involves pre-incubating the antibody with its target peptide before application to your sample. Specific binding will be absent when the antibody is neutralized, while non-specific binding will remain .

What are the Critical Buffer and Storage Conditions for TTC23 Antibodies?

Buffer and storage conditions significantly impact antibody performance and longevity. Based on manufacturer recommendations:

Buffer Compositions:

• Phosphate buffered solution, pH 7.4, containing 0.05% stabilizer and 50% glycerol

• PBS (without Mg²⁺ and Ca²⁺), pH 7.4, 150 mM NaCl, 0.02% sodium azide, 50% glycerol

• 0.42% Potassium phosphate, 0.87% Sodium chloride, pH 7.3, 30% glycerol, and 0.01% sodium azide

Storage Requirements:

• Store antibodies at -20°C for long-term storage

• Aliquot antibodies to avoid repeated freeze/thaw cycles

• For short-term use, some antibodies can be stored at 4°C

• Valid for 12 months when properly stored

Shipping Considerations:

• Antibodies are typically shipped with ice packs

• Upon receipt, store immediately at the recommended temperature

Proper handling is crucial for maintaining antibody efficacy, as repeated freeze/thaw cycles can lead to protein denaturation and reduced performance in experimental applications.

What is the Molecular Structure and Function of TTC23?

Understanding the target protein is essential for proper experimental design with TTC23 antibodies.

Structural Characteristics:

• Contains tetratricopeptide repeat (TPR) motifs

• TPR consists of degenerate 34 amino acid sequence motifs in tandem arrays of 3-16

• These repeats fold together to produce a single, linear solenoid domain called TPR domain

• Calculated molecular weight: 50 kDa

• Human TTC23 protein length: 447 amino acid residues

Functional Properties:

• Participates positively in the ciliary Hedgehog (Hh) signaling pathway

• TPR motifs form scaffolds that mediate protein-protein interactions

• Often involved in the assembly of multiprotein complexes

• Subcellular localization: primarily in cell projections

Associated Conditions:

• Diseases associated with TTC23 include cervical cancer and cervicitis

• Research areas include Cancer, Epigenetics and Nuclear Signaling

This structural and functional information provides context for experimental design and interpretation when working with TTC23 antibodies.

How Do Different TTC23 Antibody Clones Compare in Performance?

The research community has access to both polyclonal and monoclonal antibodies targeting TTC23, with varying characteristics:

Immunogen Differences:

• Fusion protein of human TTC23 (full length)

• Synthetic peptides from C-terminal region

• Synthetic peptides from N-terminal region

• KLH-conjugated synthetic peptides

Clone-Specific Performance:

Epitope Considerations:

• N-terminal targeting antibodies may detect additional isoforms

• C-terminal antibodies like HPA040369 target the sequence: ECVPILRELAGVEQALGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAVASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQ

• Different epitopes may be accessible in different experimental conditions

When selecting between antibodies, researchers should consider the specific protein region of interest and whether detecting all isoforms or a specific isoform is important for their experimental questions .

What Are Best Practices for TTC23 Detection in Immunohistochemistry?

Immunohistochemistry (IHC) presents specific challenges and considerations for TTC23 detection:

Protocol Optimization:

• Dilution range: 1:25-1:100 for most antibodies

• Verified in both paraffin-embedded (IHC-P) and frozen sections (IHC-F)

• Antigen retrieval methods may need optimization (not explicitly specified in sources)

Tissue Selection:

• Human liver cancer tissue has been verified for TTC23 IHC

• Consider using tissue microarrays for comparative studies across multiple samples

Controls:

• Primary antibody omission control

• Isotype control (rabbit IgG)

• Blocking peptide control when available

Signal Enhancement:

• For weak signals, consider signal amplification systems

• Biotin-streptavidin systems may enhance detection sensitivity

• Balance signal enhancement with risk of increased background

The Sigma HPA040369 antibody has been extensively validated for IHC applications through the Human Protein Atlas project, which provides valuable reference images for expected staining patterns .

How Should Researchers Troubleshoot Weak or Non-specific TTC23 Antibody Signals?

When encountering difficulties with TTC23 detection, systematic troubleshooting approaches can help resolve issues:

For Western Blotting:

• Sample Preparation Issues

  • Ensure complete protein extraction and denaturation

  • Verify protein loading (25-50 μg total protein recommended)

  • Check protein transfer efficiency with reversible stains

• Antibody Optimization

  • Titrate antibody concentration (start with 1:500-1:2000)

  • Extend primary antibody incubation (overnight at 4°C)

  • Optimize blocking conditions (5% non-fat dry milk or BSA)

• Detection System

  • Ensure secondary antibody compatibility with primary

  • Verify HRP conjugate activity with substrate tests

  • Consider more sensitive detection reagents for low abundance targets

For Immunohistochemistry:

• Tissue Processing

  • Optimize fixation time (overfixation can mask epitopes)

  • Try different antigen retrieval methods

  • Reduce background with appropriate blocking sera

• Signal Enhancement

  • Use amplification systems for weak signals

  • Extend chromogen development time

  • Consider fluorescent secondary antibodies for better signal-to-noise ratio

• Specificity Controls

  • Use blocking peptides to confirm signal specificity

  • Include known positive (human liver cancer) and negative controls

When persistent issues occur, comparing multiple antibodies targeting different epitopes can help determine if the problem is antibody-specific or related to the experimental system.

What is Known About TTC23 Expression Patterns Across Tissues?

Understanding the normal expression patterns of TTC23 is crucial for experimental planning and interpretation:

Verified Expression:

• Mouse adrenal gland (Western blot)

• Human liver cancer (IHC)

• Rat liver (Western blot)

Species Reactivity:

• Most antibodies detect human and mouse TTC23

• Some predicted cross-reactivity with pig, bovine, horse, sheep, and dog

Database Resources:

• Human Protein Atlas (referenced by Sigma HPA040369) provides extensive tissue expression data

• This resource can help researchers identify high and low expressing tissues for controls

Expression in Disease:

• Associated with cervical cancer and cervicitis

• May be altered in contexts where Hedgehog signaling is dysregulated

Researchers should consult the Human Protein Atlas for comprehensive expression data across normal and pathological tissues to inform experimental design.

How Can Researchers Study TTC23 Protein-Protein Interactions?

The TPR domains in TTC23 suggest an important role in protein-protein interactions, which can be studied through several approaches:

Co-Immunoprecipitation:

• Some TTC23 antibodies are validated for immunoprecipitation

• Mild lysis conditions are recommended to preserve protein complexes

• Mass spectrometry analysis of co-precipitated proteins can identify novel interactors

Proximity Ligation Assays:

• Combines antibody technology with rolling circle amplification

• Can visualize and quantify protein interactions in situ

• Requires antibodies from different host species against potential interaction partners

Functional Studies in Hedgehog Signaling:

• Since TTC23 participates in Hedgehog signaling , study interactions with:

  • Smoothened (SMO)

  • Patched (PTCH)

  • GLI transcription factors

  • Primary cilia components

Structural Considerations:

• The TPR domains in TTC23 form scaffolds that mediate protein-protein interactions

• Target these domains specifically when designing interaction experiments

• Consider antibodies that don't interfere with the interaction domains for co-IP studies

When studying TTC23 interactions, incorporating both biochemical (co-IP) and cell-based (imaging) approaches provides complementary evidence for biological interactions.

What Role Does TTC23 Play in Hedgehog Signaling and Disease?

The involvement of TTC23 in Hedgehog signaling represents an important research direction:

Hedgehog Pathway Involvement:

• TTC23 "participates positively in the ciliary Hedgehog (Hh) signaling"

• Likely functions in primary cilia, where key Hedgehog components localize

• May serve as a scaffold protein through its TPR domains

Disease Implications:

• Associated with cervical cancer

• Hedgehog pathway dysregulation is implicated in multiple cancer types

• May play roles in developmental disorders involving Hedgehog signaling

Research Approaches:

• Study TTC23 localization in ciliated cells using immunofluorescence

• Examine effects of TTC23 knockdown on Hedgehog target gene expression

• Investigate TTC23 levels in Hedgehog-dependent cancer types

Therapeutic Relevance:

• Hedgehog pathway inhibitors are in clinical use for certain cancers

• Understanding TTC23's role could identify new therapeutic targets

• Antibodies can serve as tools to study drug effects on TTC23 expression or localization

Further research into TTC23's specific molecular mechanisms in Hedgehog signaling could yield important insights into both developmental biology and disease pathogenesis.

What Are the Advanced Imaging Applications for TTC23 Antibodies?

TTC23 antibodies can be employed in sophisticated imaging techniques to elucidate protein function and localization:

Super-Resolution Microscopy:

• Compatible with appropriately conjugated secondary antibodies

• Can resolve TTC23 localization within subdomains of primary cilia

• Requires highly specific antibodies with minimal background

Live Cell Imaging:

• Requires cell-permeable antibody fragments or fluorescent protein tagging

• Allows dynamic tracking of TTC23 during signaling events

• Can reveal temporal aspects of TTC23 function

Multi-Channel Co-localization:

• Combine TTC23 antibodies with markers for:

  • Primary cilia (acetylated tubulin)

  • Hedgehog pathway components (SMO, PTCH1, GLI)

  • Centrosomal markers (γ-tubulin)

Tissue-Level Analysis:

• Multiplexed immunofluorescence can reveal cell-type specific expression

• Whole-slide scanning provides spatial context in tissues

• 3D reconstruction from tissue sections can show relationships to tissue architecture

When implementing advanced imaging, careful antibody validation is essential, as artifacts can be misinterpreted as biological findings, especially at high magnification or in super-resolution applications.

How Do Post-Translational Modifications Affect TTC23 Function and Detection?

Understanding post-translational modifications (PTMs) of TTC23 is important for comprehensive analysis:

Known and Predicted PTMs:

• Limited specific information is available about TTC23 PTMs

• TPR-containing proteins are often regulated by phosphorylation

• Sigma HPA040369 antibody targets "unmodified" TTC23

PTM Effects on Antibody Binding:

• Modifications near or within antibody epitopes may affect recognition

• Phosphorylation, acetylation, or ubiquitination can mask epitopes

• Different antibody clones may have varying sensitivity to PTMs

Experimental Approaches:

• Use phosphatase treatment before Western blotting to detect phosphorylated forms

• Employ PTM-specific antibodies (if available) in parallel with total TTC23 antibodies

• Consider mass spectrometry for comprehensive PTM mapping

Functional Significance:

• PTMs likely regulate TTC23's role in Hedgehog signaling

• May affect protein-protein interactions mediated by TPR domains

• Could be dynamically regulated during development or disease progression

While current literature lacks detailed information on TTC23 PTMs, this represents an important area for future research, particularly in understanding how TTC23 function is regulated in different cellular contexts.