TXNRD3 Antibody

Shipped with Ice Packs
In Stock

Product Specs

Buffer
PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
Typically, we can ship your order within 1-3 business days of receiving it. Delivery times may vary depending on the shipping method and destination. For specific delivery timelines, please consult your local distributors.
Synonyms
TGR antibody; Thioredoxin and glutathione reductase antibody; Thioredoxin glutathione reductase antibody; Thioredoxin reductase 2 antibody; Thioredoxin reductase 3 antibody; Thioredoxin reductase TR2 antibody; TR2 antibody; TRXR3 antibody; TRXR3_HUMAN antibody; TXNRD3 antibody
Target Names
TXNRD3
Uniprot No.

Target Background

Function
TXNRD3 Antibody detects thioredoxin reductase, glutaredoxin, and glutathione reductase activities. It catalyzes disulfide bond isomerization. This antibody promotes disulfide bond formation between GPX4 and various sperm proteins, potentially playing a role in sperm maturation by promoting the formation of sperm structural components.
Gene References Into Functions
  1. This research provides the first characterization of hTGR, offering new insights into its reaction mechanism and the regulation of monothiol Grx-containing thioredoxin glutathione reductases. PMID: 29222842
  2. This study highlights the role of GPx2, TrxR2, and TrxR3 in proliferation, apoptosis, and consequently, cancer development. PMID: 22683372
  3. This study examines the use of a non-AUG (CUG) start codon in the mouse thioredoxin reductase 3 gene and the conservation of this site in other mammals. PMID: 20018845
Database Links

HGNC: 20667

OMIM: 606235

KEGG: hsa:114112

STRING: 9606.ENSP00000430031

UniGene: Hs.477475

Protein Families
Class-I pyridine nucleotide-disulfide oxidoreductase family
Subcellular Location
Cytoplasm. Nucleus. Microsome. Endoplasmic reticulum.

Q&A

What is TXNRD3 and why is it important in redox biology research?

Thioredoxin reductase 3 (TXNRD3) is a selenocysteine-containing flavoenzyme that belongs to the thioredoxin reductase family. Unlike the other two mammalian TXNRD isoforms (TXNRD1 and TXNRD2), TXNRD3 contains an additional N-terminal glutaredoxin domain that allows it to participate in both thioredoxin and glutathione antioxidant systems . This unique domain organization makes TXNRD3 capable of reducing both thioredoxin and glutathione in an NADPH-dependent manner.

TXNRD3 is particularly important in redox biology for several reasons:

  • It plays a critical role in male reproduction via thiol redox control of spermatogenesis

  • It has been implicated in cancer drug resistance mechanisms

  • Its mitochondrial isoform (mtTXNRD3) affects cellular metabolism and survival pathways

  • It represents a potential therapeutic target, particularly in triple-negative breast cancer

While TXNRD1 (cytosolic) and TXNRD2 (mitochondrial) are ubiquitously expressed and essential for embryonic development, TXNRD3 expression is largely restricted to the testis and is not essential for viability, as demonstrated by viable TXNRD3 knockout mice .

What are the key specifications researchers should consider when selecting a TXNRD3 antibody?

When selecting a TXNRD3 antibody for research applications, researchers should consider:

ParameterConsiderations
Antibody TypePolyclonal antibodies offer broad epitope recognition but batch-to-batch variability; currently most commercial TXNRD3 antibodies are polyclonal
Species ReactivityEnsure antibody reactivity matches your experimental model (human, mouse, etc.)
ApplicationsVerify validation for your specific application (WB, IHC, IF, ELISA)
ImmunogenCheck if the immunogen sequence matches your region of interest; some target specific sequences like "KSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLL"
Isoform SpecificityConsider whether the antibody can distinguish between cytosolic (66.6 kDa) and mitochondrial (70.7 kDa) TXNRD3 isoforms
ValidationLook for evidence of antibody specificity, such as testing in TXNRD3 knockout models or siRNA knockdown validation

Researchers should note that TXNRD3 has multiple isoforms and can undergo post-translational modifications, which may affect antibody recognition. Additionally, TXNRD3-specific antibodies should be validated for cross-reactivity with other TXNRD family members (TXNRD1 and TXNRD2) to ensure specificity .

How can researchers effectively validate TXNRD3 antibody specificity in their experimental systems?

Thorough validation of TXNRD3 antibody specificity is critical for experimental integrity. A comprehensive validation strategy includes:

  • Genetic knockdown/knockout controls:

    • Use siRNA-mediated TXNRD3 knockdown as a negative control. The search results demonstrate siRNA transfection with 20 nM TXNRD3-specific siRNAs using Lipofectamine RNAiMAX in cancer cell lines

    • Utilize tissue/cells from TXNRD3 knockout mice when available

    • Compare signal between tissues with known high expression (testis) versus low expression tissues

  • Peptide competition assay:

    • Pre-incubate the antibody with excess immunogenic peptide before application

    • Signal should be significantly reduced if the antibody is specific

  • Multiple antibody comparison:

    • Use two or more antibodies targeting different TXNRD3 epitopes

    • Consistent patterns across antibodies suggest specific detection

  • Cross-reactivity assessment:

    • Test for cross-reactivity with TXNRD1 and TXNRD2 in overexpression systems

    • Include parallel knockdown of all three isoforms to confirm specificity

  • Mass spectrometry validation:

    • Immunoprecipitate with TXNRD3 antibody and confirm identity by mass spectrometry

    • This provides definitive evidence of antibody specificity

A rigorous validation example was demonstrated in recent TXNRD3 research, where knockdown validation was performed by Western blot following siRNA transfection, showing significant reduction in TXNRD3 levels (>70% reduction) while control siRNA had no effect .

What are the optimal protocols for detecting TXNRD3 in different sample types and research applications?

Western Blot Protocol for TXNRD3 Detection:

  • Sample preparation:

    • For cell lines: Lyse cells in RIPA buffer supplemented with protease inhibitors

    • For tissue samples: Homogenize in RIPA buffer (testis tissue yields strongest signals)

    • Load 30-50 μg protein per lane

  • Electrophoresis and transfer:

    • Use 8-10% SDS-PAGE gels (TXNRD3 is approximately 70-77 kDa)

    • Transfer to PVDF membrane at 100V for 1 hour

  • Antibody incubation:

    • Block with 5% non-fat milk in TBST for 1 hour

    • Incubate with primary TXNRD3 antibody at 1:200-1:2000 dilution overnight at 4°C

    • Wash 3× with TBST

    • Incubate with HRP-conjugated secondary antibody for 1 hour

    • Develop using ECL system

Immunohistochemistry Protocol:

  • Sample preparation:

    • Fix tissues in 4% paraformaldehyde

    • Embed in paraffin and section at 4-6 μm thickness

  • Staining:

    • Deparaffinize and rehydrate sections

    • Perform antigen retrieval (citrate buffer, pH 6.0)

    • Block endogenous peroxidase with 3% H₂O₂

    • Block with 5% normal serum

    • Incubate with TXNRD3 antibody at 1:20-1:200 dilution overnight at 4°C

    • Apply secondary antibody and develop using DAB substrate

ELISA Protocol:
For quantitative measurement of TXNRD3 levels, researchers have used:

  • Human Thioredoxin Reductase 3 (TXNRD3) ELISA Kit (e.g., abx384053, Abbexa)

  • Protocol follows manufacturer's instructions with 5 × 10⁵ cells collected after treatment

  • Protein extraction followed by ELISA analysis yields quantifiable results

Immunofluorescence Protocol:

  • Fix cells in 4% paraformaldehyde for 15 minutes

  • Permeabilize with 0.2% Triton X-100 for 10 minutes

  • Block with 3% BSA for 1 hour

  • Incubate with TXNRD3 antibody at 0.25-2 μg/mL overnight at 4°C

  • Apply fluorochrome-conjugated secondary antibody

  • Counterstain nuclei with DAPI

  • Mount and image using confocal microscopy

Each application requires optimization based on specific antibody characteristics and experimental conditions.

How can TXNRD3 antibodies be utilized to investigate the role of TXNRD3 in cancer drug resistance?

Recent research has demonstrated that TXNRD3, particularly its mitochondrial isoform, plays a significant role in cancer drug resistance through redox-mediated mechanisms. TXNRD3 antibodies are instrumental in exploring these resistance mechanisms through several methodological approaches:

  • Expression analysis in resistant vs. sensitive cells:

    • Use TXNRD3 antibodies to compare protein levels between drug-sensitive and resistant cancer cells

    • Research has shown significantly increased TXNRD3 protein levels in Osimertinib-persister TNBC cells compared to parental cells

    • Western blot analysis revealed >2-fold higher TXNRD3 expression in resistant lines

  • Co-immunoprecipitation studies to identify interacting partners:

    • TXNRD3 antibodies can be used to pull down protein complexes

    • This approach revealed that TXNRD3 interacts with thioredoxin 2 (Trx2), which stabilizes anti-apoptotic proteins including Bcl-XL, Bcl-2, and MCL-1

    • Understanding these interactions helps elucidate resistance mechanisms

  • Subcellular localization in drug-resistant cells:

    • Immunofluorescence with TXNRD3 antibodies shows distinct localization patterns

    • Mitochondrial TXNRD3 has been linked to metabolic alterations in resistant cells, characterized by low mitochondrial respiration and high glycolysis

  • Monitoring TXNRD3 changes during drug treatment:

    • Western blot and ELISA using TXNRD3 antibodies can track changes in expression during drug treatment

    • In a study of EGFR inhibitor resistance, TXNRD3 levels were measured after treatment with Auranofin (0–2.5 µM), showing dose-dependent reduction in TXNRD3 levels

  • Combination therapy validation:

    • TXNRD3 antibodies help confirm target engagement in studies combining TXNRD3 inhibitors with other cancer drugs

    • Research showed that combined TXNRD3 inhibition with EGFR inhibitors significantly reduced cancer cell viability

These methodologies have successfully demonstrated that TXNRD3 inhibition sensitizes triple-negative breast cancer cells to EGFR inhibitors, presenting a promising strategy for overcoming drug resistance in these aggressive cancers .

What insights have TXNRD3 antibody-based studies revealed about its role in male fertility and reproductive biology?

TXNRD3 antibody-based studies have provided critical insights into TXNRD3's role in male fertility and reproductive biology. These studies have employed sophisticated methodologies that revealed:

  • Tissue-specific expression patterns:

    • Immunohistochemical staining using TXNRD3 antibodies demonstrated that TXNRD3 expression is largely restricted to testicular tissue

    • Expression is particularly high during spermatogenesis and in mature sperm

  • Subcellular localization during spermatogenesis:

    • Immunofluorescence studies revealed TXNRD3 localization patterns in developing sperm cells

    • TXNRD3 was found to co-localize with proteins involved in disulfide bond formation and isomerization during sperm maturation

  • Functional interactome analysis:

    • Co-immunoprecipitation with TXNRD3 antibodies followed by mass spectrometry identified interacting partners

    • String analysis showed a high confidence functional link (score of 0.717) between TXNRD3 and GPX4, another selenoprotein important for male fertility

    • GPX4 expression was higher in TXNRD3 knockout testes compared to wild-type (WT 0.77±0.11 vs. TXNRD3 -/- 0.96±0.04, p=0.049), suggesting compensatory upregulation

  • Proteomic identification of target proteins:

    • Using a sophisticated enrichment protocol and TXNRD3 antibodies, researchers identified TXNRD3 target proteins in epididymal luminal contents including sperm

    • Rather than a single target, TXNRD3 was found to reduce a broad range of proteins during sperm maturation

    • Functional enrichment analysis of 103 putative TXNRD3 targets showed enrichment for RNA-binding proteins (p-value=1.77E-5; FDR=0.024)

    • Ten mitochondrial proteins involved in metabolism were detected only in cauda sperm from TXNRD3 knockout mice, suggesting TXNRD3's role in ATP production

  • Phenotypic analysis of knockout models:

    • TXNRD3 antibodies confirmed complete absence of TXNRD3 in knockout mice, which showed fertility impairment

    • Functional studies combined with immunodetection revealed TXNRD3's role in maintaining proper thiol redox status during sperm maturation

These studies collectively demonstrated that TXNRD3 plays a critical role in male reproduction by supporting disulfide bond reduction and isomerization during spermiogenesis, with knockout models showing reduced fertilization rates in vitro and altered sperm movement .

What are common technical challenges with TXNRD3 antibodies and how can researchers address them?

ChallengeCauseSolution
High background signalNon-specific binding- Increase blocking time/concentration (5% BSA often works better than milk)
- Optimize antibody dilution (try 1:500-1:2000 range)
- Include 0.1-0.3% Triton X-100 in antibody diluent
- Pre-adsorb antibody with tissue powder from knockout animals
No signal or weak signalLow protein abundance or epitope accessibility- Increase protein loading (50-100 μg)
- Try alternative antigen retrieval methods for IHC (citrate buffer pH 6.0 vs. EDTA pH 8.0)
- Extend primary antibody incubation (overnight at 4°C)
- Use signal amplification systems (tyramide or polymer-based)
Multiple bands in Western blotIsoform detection or degradation- TXNRD3 has cytosolic (66.6 kDa) and mitochondrial (70.7 kDa) isoforms
- Use fresh samples with protease inhibitors
- Run positive control (testis tissue)
- Perform peptide competition assay to identify specific bands
Inconsistent results between applicationsApplication-specific optimization required- Optimize fixation for IF/IHC (4% PFA works well)
- Use RIPA buffer for Western blot extraction
- For IP, use gentler lysis buffers (NP-40 based)
- Validate each application independently
Cross-reactivity with other TXNRDsSequence homology between family members- Pre-validate using siRNA knockdown of specific TXNRD isoforms
- Confirm specificity using TXNRD3 knockout samples
- Select antibodies targeting unique TXNRD3 regions

Methodological solution for cross-reactivity assessment:

A systematic approach used in recent research involved:

  • Transfecting cells with siRNAs targeting TXNRD1, TXNRD3, or non-specific control

  • Confirming knockdown efficiency via qRT-PCR

  • Performing Western blot with the TXNRD3 antibody

  • Observing signal reduction only in TXNRD3 knockdown samples confirms specificity

When working with tissues, researchers have effectively used TXNRD3 knockout mice as negative controls to confirm antibody specificity, demonstrating complete absence of signal in knockout tissues while maintaining detection of other TXNRD family members .

How should researchers interpret seemingly contradictory TXNRD3 data across different experimental systems?

When faced with contradictory TXNRD3 data across different experimental systems, researchers should employ a systematic analytical approach:

  • Evaluate tissue and cell type specificity:

    • TXNRD3 expression is highly tissue-specific, with predominant expression in testis

    • In cancer cells, expression patterns may differ substantially from normal tissues

    • Example: In a study comparing different cancer cell lines, TXNRD3 expression varied by more than 10-fold between high-expressing (testicular cancer lines) and low-expressing (lung cancer) cell lines

  • Consider isoform-specific expression:

    • TXNRD3 has both cytosolic (66.6 kDa) and mitochondrial (70.7 kDa) isoforms

    • Different antibodies may preferentially detect specific isoforms

    • Resolution: Western blots should be run with adequate separation to distinguish these isoforms

  • Analyze oxidative stress conditions:

    • TXNRD3 function is inherently linked to cellular redox status

    • Contradictory findings may result from different basal oxidative stress levels

    • Solution: Measure and report parallel markers of oxidative stress (ROS levels, GSH/GSSG ratio)

    • Example: Researchers observed that TXNRD3 knockdown significantly increased ROS levels in cancer cells, which affected EGFR phosphorylation

  • Assess compensatory mechanisms:

    • TXNRD family members may compensate for each other

    • GPX4 expression was higher in TXNRD3 knockout testes compared to wild-type (WT 0.77±0.11 vs. TXNRD3 -/- 0.96±0.04, p=0.049)

    • Thioredoxin 1 expression was also higher in TXNRD3-/- sperm, suggesting compensatory upregulation

    • Recommendation: Always measure multiple components of the thioredoxin system

  • Standardize experimental conditions:

    • Use consistent cell densities, passage numbers, and treatment durations

    • Example: In TXNRD3 inhibition studies, sensitivity to Auranofin varied significantly based on treatment duration (24h vs. 72h exposure showed >30% difference in IC50)

  • Validate with orthogonal approaches:

    • Combine antibody detection with functional assays (thioredoxin reductase activity)

    • Confirm protein-level findings with mRNA expression data

    • Utilize genetic approaches (siRNA, CRISPR) alongside pharmacological inhibition

A notable case of apparent contradiction was resolved in research showing that while TXNRD3 is generally a reductase, its role in sperm maturation involves disulfide bond isomerization rather than simply reduction . This functional duality explains seemingly contradictory observations and highlights the importance of considering context-specific roles.

What emerging techniques involving TXNRD3 antibodies hold promise for advancing redox biology and cancer research?

Several cutting-edge techniques incorporating TXNRD3 antibodies are poised to advance our understanding of redox biology and cancer research:

  • Proximity labeling coupled with proteomics:

    • BioID or APEX2 fusion with TXNRD3 allows identification of proximal interacting proteins

    • This approach could reveal transient interactions in the dynamic redox environment

    • Application: Identifying previously unknown TXNRD3 substrates in cancer cells under varying oxidative stress conditions

    • This could expand on current findings that TXNRD3 interacts with a broad range of protein targets

  • Single-cell proteomics with TXNRD3 antibodies:

    • Mass cytometry (CyTOF) with TXNRD3 antibodies enables single-cell protein analysis

    • Can reveal heterogeneity in TXNRD3 expression within tumors

    • Correlation with drug resistance markers at single-cell resolution

    • This builds on findings that TXNRD3 levels correlate with drug resistance in cancer cell populations

  • In situ redox sensing coupled with TXNRD3 visualization:

    • Combining fluorescent redox sensors (roGFP) with immunofluorescence

    • Spatiotemporal correlation between TXNRD3 localization and redox changes

    • This could elucidate how TXNRD3 inhibition leads to increased ROS and subsequent EGFR phosphorylation

  • TXNRD3-targeted drug delivery systems:

    • Antibody-drug conjugates targeting TXNRD3-expressing cells

    • Nanoparticles decorated with TXNRD3 antibody fragments

    • Potential for selective targeting of cancer cells with elevated TXNRD3

    • This approach could leverage findings that TXNRD3 is upregulated in certain drug-resistant cancers

  • CRISPR-based screening with TXNRD3 antibody validation:

    • Building on the genome-wide CRISPR screen that identified TXNRD3 as a mediator of Erlotinib resistance

    • Using TXNRD3 antibodies to validate hits from CRISPR screens targeting redox pathways

    • Potential to discover synthetic lethal interactions with TXNRD3 inhibition

  • Spatial transcriptomics combined with TXNRD3 immunohistochemistry:

    • Correlating TXNRD3 protein expression with spatial gene expression patterns

    • Understanding the tumor microenvironment's influence on TXNRD3 expression

    • This could provide insights into the heterogeneous expression of TXNRD3 observed in tumor tissues

These emerging techniques could significantly advance our understanding of TXNRD3's role in redox biology and cancer, potentially leading to novel therapeutic strategies targeting this unique redox enzyme.

How might TXNRD3 antibodies contribute to the development of novel therapeutic approaches for cancer treatment?

TXNRD3 antibodies are poised to make significant contributions to novel cancer therapeutic approaches through several methodological pathways:

  • Companion diagnostics for TXNRD3-targeted therapies:

    • Immunohistochemistry with validated TXNRD3 antibodies could identify patients likely to respond to TXNRD3 inhibitors

    • Recent research demonstrated that TXNRD3 inhibition with Auranofin sensitized EGFR-high TNBC cells to EGFR inhibitors

    • Patient stratification based on TXNRD3 expression could improve clinical trial outcomes for combination therapies

  • Mechanistic insights for rational drug combinations:

    • TXNRD3 antibodies enable investigation of mechanistic synergies between drugs

    • Example: Research showed TXNRD3 inhibition increases oxidative stress-mediated accumulation of phosphorylated EGFR and enhances its surface localization

    • This mechanism explained why TXNRD3 inhibition sensitized cancer cells to anti-EGFR therapies, a finding that could not have been made without TXNRD3 antibodies

  • Monitoring treatment response and resistance development:

    • Serial biopsies analyzed with TXNRD3 antibodies can track expression changes during treatment

    • Studies found TXNRD3 protein levels significantly increased in Osimertinib-persister cells compared to parental cells

    • This suggests TXNRD3 upregulation as a resistance mechanism that could be monitored during treatment

  • Development of novel antibody-based therapeutics:

    • Anti-TXNRD3 antibodies could be developed as direct therapeutics

    • Bispecific antibodies linking TXNRD3 to immune effector cells

    • Antibody-drug conjugates delivering cytotoxic payloads to TXNRD3-expressing cells

  • Combination therapy optimization:

    • TXNRD3 antibodies allow quantitative assessment of target modulation

    • Research using ELISA with TXNRD3 antibodies showed Auranofin reduced TXNRD3 levels in a concentration-dependent manner in TNBC cells

    • This information enabled optimization of dosing schedules for maximum synergy with EGFR inhibitors

  • Unraveling resistance mechanisms to existing therapies:

    • Proteomics studies with TXNRD3 antibodies revealed its interaction with apoptotic regulators

    • High TXNRD3 activity maintained thioredoxin 2 in a reduced state, stabilizing anti-apoptotic proteins Bcl-XL, Bcl-2, and MCL-1

    • This mechanism explains how TXNRD3 contributes to drug resistance and suggests rational combinations with Bcl-2 family inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.