The TYW5 antibody (Anti-TYW5, produced in rabbit) is an affinity-isolated immunoglobulin designed for targeted detection of the TYW5 protein in experimental settings. Key specifications include:
| Property | Detail |
|---|---|
| Biological Source | Rabbit |
| Reactivity | Human |
| Applications | Immunoblotting (0.04–0.4 µg/mL), Immunohistochemistry (1:50–1:200 dilution) |
| Immunogen Sequence | KRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEE... |
| Storage Conditions | −20°C in buffered aqueous glycerol solution |
| Gene Information | Human TYW5 (UniProt ID: Q6IPR1) |
This antibody is part of the Prestige Antibodies® line, rigorously validated for specificity and low cross-reactivity using protein arrays and tissue microarrays .
TYW5 antibodies are critical tools in neuroscience and genetics research, particularly for:
Protein Localization: Mapping TYW5 expression in human brain tissues via immunohistochemistry .
Mechanistic Studies: Investigating TYW5's role in neural stem cell proliferation and dendritic spine morphogenesis .
Pathological Analysis: Comparing TYW5 expression levels in schizophrenia patients versus controls .
Recent studies highlight TYW5's significance in neuropsychiatric disorders:
Genetic Regulation: Single nucleotide polymorphisms (SNPs) rs796364 and rs281759 regulate TYW5 expression, with risk alleles linked to upregulated TYW5 in schizophrenia patients’ brains .
Functional Impact:
CRISPR-Cas9 Knockout: Confirmed regulatory effects of rs796364/rs281759 on TYW5 transcription .
Transcriptome Analysis: TYW5 influences pathways implicated in schizophrenia, including neurodevelopment and synaptic plasticity .
TYW5, or tRNA-tyrosine 5-monooxygenase, is a critical enzyme that catalyzes the hydroxylation of the uridine residue at position 5 of tRNA-Tyr during post-translational modification of tRNA. This modification is essential for proper tRNA functioning, as it significantly enhances translational fidelity by ensuring the correct amino acid incorporation into the growing polypeptide chain. The enzymatic activity of TYW5 represents a critical checkpoint in protein synthesis quality control, making it an important focus in molecular biology research . Researchers investigating translational dynamics, tRNA modifications, and their impacts on cellular processes frequently utilize TYW5 antibodies to examine expression patterns and localization. The significant role of TYW5 in maintaining translational fidelity makes it a valuable research target for understanding mechanisms underlying gene expression and protein synthesis disorders .
TYW5 antibodies have been validated for multiple experimental applications, enabling comprehensive characterization of this protein across various research contexts:
When designing experiments, researchers should consider that different antibody preparations may have varying sensitivities across these applications. Validation of antibody specificity in your experimental system is recommended before proceeding with comprehensive studies. For optimal results, preliminary titration experiments should be conducted to determine the ideal antibody concentration for your specific application and cell/tissue type .
The choice between monoclonal and polyclonal TYW5 antibodies should be guided by your specific experimental requirements and research objectives:
Monoclonal TYW5 Antibodies (e.g., G-9):
Offer high specificity for a single epitope, reducing background signal
Provide consistent lot-to-lot reproducibility for longitudinal studies
Particularly suitable for applications requiring precise epitope targeting
Recommended for experiments where signal specificity is critical, such as co-localization studies
Available as mouse monoclonal IgG2b that detects TYW5 in mouse, rat, and human samples
Polyclonal TYW5 Antibodies:
Recognize multiple epitopes on the TYW5 protein
Often provide stronger signals due to binding at multiple sites
Better for detecting proteins present at low expression levels
Available as rabbit polyclonal antibodies targeting the middle region of TYW5
Particularly useful for applications like western blotting where signal amplification is beneficial
For neurodevelopmental studies examining TYW5's role in schizophrenia pathophysiology, polyclonal antibodies may provide better detection sensitivity, while monoclonal antibodies might offer cleaner results in co-immunoprecipitation experiments aimed at identifying TYW5 interaction partners. Many laboratories utilize both types complementarily to validate findings across different experimental approaches .
Recent genomic studies have established a compelling link between TYW5 and schizophrenia, with genetic variants at locus 2q33.1 (particularly rs796364 and rs281759) conferring schizophrenia risk by modulating TYW5 expression . To investigate this association, researchers can implement a multi-faceted approach utilizing TYW5 antibodies:
Expression Analysis in Patient Samples:
Use TYW5 antibodies for western blotting or immunohistochemistry to quantify expression levels in post-mortem brain tissue from schizophrenia patients versus controls
Correlate expression with genotype at rs796364 and rs281759 to validate genetic association findings
Cellular Phenotype Investigation:
Molecular Pathway Analysis:
Use TYW5 antibodies for immunoprecipitation followed by mass spectrometry to identify interaction partners
Map these interactions to known schizophrenia-associated pathways
Researchers have demonstrated that TYW5 is significantly upregulated in the brains of schizophrenia cases compared to controls, and experimental overexpression affects both neurodevelopment and dendritic spine formation - two critical processes implicated in schizophrenia pathophysiology . TYW5 antibodies therefore represent an essential tool for examining the mechanistic links between genetic risk factors and cellular phenotypes in schizophrenia research.
When investigating TYW5's role in neurodevelopment using antibody-based techniques, several methodological considerations are crucial for obtaining reliable results:
Developmental Stage Specificity:
TYW5 expression patterns may vary across developmental stages
Design sampling timepoints that capture critical neurodevelopmental windows
Include age-matched controls when comparing disease models
Cell Type Heterogeneity:
Neural tissue contains diverse cell populations with potentially different TYW5 expression profiles
Consider complementing standard immunohistochemistry with single-cell approaches
For in vitro studies, validate antibody in both neural stem cells and differentiated neurons
Validation in Multiple Models:
Technical Optimization:
Fixation methods can significantly impact epitope accessibility in neural tissues
Test multiple antigen retrieval methods when necessary
Consider signal amplification techniques for detecting low expression levels
Functional Correlation:
By carefully addressing these methodological considerations, researchers can effectively utilize TYW5 antibodies to investigate its critical roles in neurodevelopment and potential contributions to neurodevelopmental disorders like schizophrenia.
Integrating CRISPR-Cas9 genome editing with TYW5 antibodies creates a powerful approach for investigating how regulatory variants affect TYW5 expression and function. This methodology has been successfully employed to confirm the regulatory effects of single nucleotide polymorphisms (SNPs) rs796364 and rs281759 on TYW5 expression . A comprehensive experimental workflow would include:
CRISPR-Cas9 Editing of Regulatory Elements:
Design sgRNAs targeting the genomic regions containing rs796364 and rs281759
Introduce precise edits to convert risk alleles to non-risk alleles (or vice versa)
Generate isogenic cell lines differing only at the targeted regulatory variants
Validation of Editing Efficiency:
Confirm successful editing through genomic DNA sequencing
Verify that other regions potentially affecting TYW5 expression remain unchanged
TYW5 Expression Analysis:
Use TYW5 antibodies in western blot analysis to quantify protein expression changes
Employ immunofluorescence to assess potential alterations in subcellular localization
Compare expression levels between edited and control cell lines
Functional Assessment:
Investigate phenotypic consequences of altered TYW5 expression
Examine neural stem cell proliferation and differentiation through appropriate markers
Quantify dendritic spine morphology changes in neuronal models
Previous research has successfully implemented this integrated approach using lentiCRISPR v2 vectors with sgRNAs targeting rs796364 and rs281759, followed by puromycin selection to establish stably edited cell lines. Subsequent qPCR and western blot analysis with TYW5 antibodies confirmed the regulatory effects of these variants on TYW5 expression . This combined approach provides mechanistic insights into how genetic variants at 2q33.1 contribute to schizophrenia risk through the modulation of TYW5 expression.
Western blotting with TYW5 antibodies can present several challenges that may affect result quality and reproducibility. Here are common issues researchers encounter and evidence-based solutions:
When detecting TYW5, remember that it has a molecular weight of approximately 36 kDa, but post-translational modifications may affect migration patterns . For applications requiring higher specificity, consider using neutralizing peptides as competitive controls to confirm band identity . Additionally, sample preparation is critical - TYW5 is involved in nuclear processes, so ensure your lysis protocol efficiently extracts nuclear proteins.
Optimizing immunofluorescence protocols for TYW5 detection in neural tissue requires careful attention to several parameters that can significantly impact signal quality and specificity:
Fixation Method Selection:
Paraformaldehyde (4%) is generally suitable for TYW5 detection
For detailed subcellular localization studies, compare PFA with methanol fixation
Brief (10-20 min) fixation times may preserve antigenicity better than extended periods
Antigen Retrieval Optimization:
Heat-mediated retrieval in citrate buffer (pH 6.0) often improves TYW5 epitope accessibility
Test both heat-mediated and enzymatic retrieval methods if initial staining is weak
For mouse brain sections, a stepped retrieval approach (65°C for 30 min followed by 95°C for 10 min) may yield superior results
Signal Amplification Considerations:
Given TYW5's role in tRNA modification, expression levels may be moderate in some neural cell types
Consider tyramide signal amplification for detecting low-abundance expression
Biotin-streptavidin systems can enhance signal while maintaining specificity
Dual Labeling Strategy:
Co-stain with neuronal markers (MAP2, NeuN) or glial markers (GFAP) to identify cell-type specific expression
When examining dendritic spine alterations, combine with spine markers like PSD-95
Use confocal microscopy with appropriate controls to confirm co-localization
Background Reduction:
Extend blocking time (2-3 hours) with 5-10% normal serum from the species of secondary antibody
Include 0.1-0.3% Triton X-100 for permeabilization while preventing excessive antigen loss
Consider using Sudan Black B (0.1-0.3%) to reduce autofluorescence in fixed brain tissue
These optimization steps are particularly important when investigating TYW5's role in neurodevelopment and dendritic spine formation, where precise localization and co-expression patterns provide critical insights into its function in schizophrenia pathophysiology .
Discrepancies between TYW5 mRNA and protein expression levels are not uncommon and reflect the complex relationship between transcription and translation. Resolving these discrepancies requires a systematic approach:
Validation with Multiple Antibodies:
Post-Transcriptional Regulation Assessment:
Investigate microRNA-mediated regulation using prediction algorithms and validation assays
Examine RNA stability through actinomycin D chase experiments
Consider alternative splicing that might affect epitope availability
Protein Stability Analysis:
Measure protein half-life using cycloheximide chase assays
Investigate ubiquitination status of TYW5 through immunoprecipitation
Assess proteasomal degradation by treating samples with MG132
Technical Considerations:
Ensure RNA and protein are extracted from the same biological samples
Normalize data appropriately using validated housekeeping genes/proteins
Consider the sensitivity limitations of each method
Methodological Triangulation:
Complement western blotting with mass spectrometry-based quantification
Use reporter assays to measure translational efficiency
Consider polysome profiling to assess translational status of TYW5 mRNA
In schizophrenia research, this approach is particularly relevant as studies have shown TYW5 upregulation in patient brains, but the relationship between genetic variants, mRNA levels, and final protein expression is complex . When reporting discrepancies, present both mRNA and protein data with appropriate statistical analysis, and discuss potential biological mechanisms rather than dismissing results as technical artifacts.
The emerging connection between tRNA modifications and neurodegenerative pathology opens promising research avenues where TYW5 antibodies could play a pivotal role. While TYW5 has been linked to schizophrenia , its broader implications in neurodegenerative conditions warrant investigation through several approaches:
Comparative Expression Profiling:
Use TYW5 antibodies to quantify expression in post-mortem brain samples across neurodegenerative conditions (Alzheimer's, Parkinson's, ALS)
Compare expression patterns in affected versus unaffected brain regions
Correlate TYW5 levels with disease severity markers
Stress Response Investigation:
Examine TYW5 localization and expression changes during cellular stress conditions
Investigate potential co-localization with stress granules using dual immunofluorescence
Determine whether TYW5 dysfunction affects translational fidelity under stress conditions typical in neurodegeneration
Protein Aggregation Studies:
Assess whether TYW5 dysfunction contributes to protein misfolding through compromised translational accuracy
Examine potential co-localization of TYW5 with protein aggregates in disease models
Use proximity ligation assays with TYW5 antibodies to identify novel interaction partners in disease contexts
Therapeutic Target Validation:
Use TYW5 antibodies to monitor expression changes in response to experimental therapeutics
Develop cell-based screening assays incorporating TYW5 immunodetection
Validate target engagement in preclinical models
Given TYW5's established role in tRNA modification and the growing evidence linking translational fidelity to neurodegenerative mechanisms, TYW5 antibodies represent valuable tools for exploring this intersection. The discovery that TYW5 affects neurodevelopment and dendritic spine formation suggests potential roles in maintaining neuronal integrity that may be compromised in various neurodegenerative conditions.
Although TYW5 antibodies have not been extensively validated for chromatin immunoprecipitation (ChIP) applications, this technique could provide valuable insights into potential chromatin-associated functions of TYW5. When adapting TYW5 antibodies for ChIP studies, consider these critical factors:
Antibody Selection Criteria:
Choose antibodies validated for immunoprecipitation applications
Polyclonal antibodies often perform better in ChIP due to recognition of multiple epitopes
Verify that the epitope is accessible in cross-linked chromatin complexes
Cross-linking Optimization:
Test multiple formaldehyde concentrations (0.5-1.5%) and incubation times
Consider dual cross-linking with disuccinimidyl glutarate followed by formaldehyde for protein-protein interactions
Optimize sonication conditions to generate 200-500bp fragments without destroying epitopes
Controls and Validation:
Include IgG negative controls from the same species as the TYW5 antibody
Use cells with TYW5 knockdown as biological negative controls
Perform sequential ChIP (Re-ChIP) to examine co-occupation with known chromatin factors
Biological Context Considerations:
Investigate potential TYW5 association with chromatin under different cellular conditions
Based on TYW5's role in schizophrenia, examine neural differentiation stages
Consider cell-type specific differences, particularly in neuronal versus glial lineages
While TYW5's primary function involves tRNA modification, recent research has revealed unexpected roles for many tRNA-modifying enzymes in chromatin regulation. Research has shown that TYW5 expression affects schizophrenia-associated pathways , suggesting potential involvement in transcriptional regulation that could be investigated through carefully optimized ChIP experiments.
TYW5 antibodies can be instrumental in elucidating the complex relationship between tRNA modification, translational fidelity, and disease pathophysiology through multi-dimensional experimental approaches:
Ribosome Profiling Integration:
Combine TYW5 immunoprecipitation with ribosome profiling to identify mRNAs affected by TYW5 dysfunction
Correlate TYW5 expression levels (detected by immunoblotting) with ribosome occupancy patterns
Identify disease-relevant transcripts whose translation is particularly sensitive to TYW5 activity
Mistranslation Assessment:
Develop reporter systems to measure translational errors in models with altered TYW5 expression
Use TYW5 antibodies to confirm overexpression or knockdown efficiency
Correlate mistranslation rates with disease-relevant phenotypes
Stress Response Dynamics:
Monitor TYW5 protein levels and localization during various cellular stresses using immunofluorescence
Examine potential co-localization with stress granules or processing bodies
Investigate whether TYW5 dysfunction sensitizes cells to stress-induced translational dysregulation
Circuit-Level Analysis:
Use TYW5 antibodies for immunohistochemistry to map expression across neural circuits
Examine region-specific and cell-type-specific expression patterns in disease models
Correlate TYW5 expression with functional connectivity measures
Research has already established that TYW5 overexpression affects neurodevelopment and dendritic spine formation , suggesting that translational fidelity mediated by proper tRNA modification is crucial for normal neuronal function. By utilizing TYW5 antibodies in these experimental frameworks, researchers can bridge molecular mechanisms with cellular phenotypes and circuit-level dysfunction in neuropsychiatric disorders like schizophrenia.
Proper validation of TYW5 antibodies is critical for ensuring experimental reliability and reproducibility. A comprehensive validation strategy should include these essential controls:
Genetic Controls:
Positive Controls: Cell lines known to express TYW5 (based on previous literature)
Negative Controls:
TYW5 knockout or knockdown samples generated via CRISPR-Cas9 or siRNA
Tissues from species not recognized by the antibody (check cross-reactivity data)
Overexpression Controls: Cells transfected with TYW5 expression vectors
Peptide Competition Assays:
Technical Controls:
Application-Specific Controls:
Cross-Validation:
Compare results using antibodies targeting different epitopes of TYW5
Validate protein expression using orthogonal methods (e.g., mass spectrometry)
Researchers investigating TYW5's role in schizophrenia should be particularly rigorous with controls, as the reported upregulation in patient brains requires careful validation to distinguish disease-specific changes from technical artifacts .
Investigating TYW5's impact on dendritic spine morphology requires carefully designed experiments that combine molecular manipulation with high-resolution imaging. Based on evidence linking TYW5 overexpression to altered spine density , a comprehensive experimental design would include:
Molecular Manipulation Strategies:
Overexpression: Transfect neurons with TYW5 expression vectors at different expression levels
Knockdown: Use siRNA or shRNA targeting TYW5 to reduce expression
Rescue Experiments: Reintroduce wild-type or mutant TYW5 in knockdown backgrounds
Confirm Manipulation: Use TYW5 antibodies in western blotting to verify expression changes
Imaging Approaches:
Fixed Tissue Analysis:
Use high-resolution confocal microscopy (minimum 60x objective with appropriate NA)
Implement super-resolution techniques (STED, STORM) for detailed spine morphology
Co-stain with spine markers (PSD-95, drebrin) alongside TYW5 immunostaining
Live Imaging:
Generate TYW5-fluorescent protein fusions to monitor dynamic localization
Use GFP-Lifeact to visualize actin dynamics in spines alongside TYW5 manipulation
Perform time-lapse imaging to capture spine formation and elimination rates
Quantification Parameters:
Measure spine density (spines per μm of dendrite)
Classify spine morphology (mushroom, thin, stubby)
Quantify spine head diameter and neck length
Analyze spine maturity markers in relation to TYW5 expression
Experimental Conditions:
Examine developmental time course (DIV7, 14, 21 for cultured neurons)
Compare effects in different neuronal populations (pyramidal neurons vs. interneurons)
Investigate activity-dependence by combining with TTX or bicuculline treatments
This approach builds upon previous findings that TYW5 overexpression affects dendritic spine density , providing mechanistic insights into how translational fidelity contributes to synaptic development and potentially to schizophrenia pathophysiology.
Detecting low-abundance TYW5 in specific cell types presents significant technical challenges that require specialized methodological approaches:
Signal Amplification Techniques:
Tyramide Signal Amplification (TSA): Enhances sensitivity by depositing multiple fluorophores at antibody binding sites
Rolling Circle Amplification (RCA): Combines primary antibody detection with DNA amplification for exponential signal increase
Proximity Ligation Assay (PLA): Detects TYW5 and known interaction partners, generating punctate signals only where both proteins are in close proximity
Sample Enrichment Strategies:
Cell Sorting: Isolate specific cell populations using FACS prior to TYW5 analysis
Laser Capture Microdissection: Select specific cells or regions for targeted analysis
Subcellular Fractionation: Concentrate TYW5 by isolating relevant cellular compartments
High-Sensitivity Detection Methods:
Multiplexed Ion Beam Imaging (MIBI): Combines antibody detection with mass spectrometry for high-sensitivity, multiplexed protein detection
Ultrasensitive ELISA: Employ digital ELISA platforms with single-molecule detection capabilities
Mass Cytometry (CyTOF): Use metal-conjugated TYW5 antibodies for highly sensitive detection without fluorescence background concerns
Optimization for Specific Cell Types:
For neurons: Extended primary antibody incubation (48-72 hours at 4°C) with gentle agitation
For brain tissue sections: Step-wise antigen retrieval with carefully optimized temperature conditions
For dividing cells: Synchronize cell cycle to capture potential expression fluctuations
These approaches are particularly relevant for investigating TYW5's role in schizophrenia, where cell-type specific expression patterns may provide critical insights into pathophysiology. Previous research has shown that TYW5 affects neural stem cell proliferation and differentiation , suggesting that sensitivity to detect low-level expression in specific neural progenitor populations could be crucial for understanding its developmental roles.