The USF2 Antibody (16614-1-AP) is a rabbit-derived polyclonal IgG antibody targeting USF2, validated for use in Western blot (WB), immunohistochemistry (IHC), and ELISA. It exhibits reactivity with human, mouse, and rat samples, with observed molecular weight of 44 kDa (vs. a calculated 37 kDa, likely due to post-translational modifications) .
Functional Studies: Used to explore USF2’s role in autophagy, lysosomal regulation, and cancer .
Disease Research: Validated in models of chronic lymphocytic leukemia and metabolic syndromes .
USF2 regulates critical cellular processes, as demonstrated by recent studies:
Tumor Suppression: USF2 deficiency promotes proliferation, migration, and mitophagy via ERK1/2 and AKT activation, enhancing survival in prostate and breast cancers .
Mitochondrial Dysregulation: ΔUSF2 cells exhibit enlarged mitochondria with reduced cristae and ATP production, linked to altered expression of Pink1, Mfn2, and Pdk4 .
Competitive Binding: USF2 represses lysosomal biogenesis by competing with TFEB for promoter binding, a process modulated by GSK3β phosphorylation at Ser155 .
Chromatin Modulation: USF2 recruits the NuRD complex (HDAC1/2, CHD4) to reduce chromatin accessibility at autophagy-related genes like Lamp1 and Map1lc3b .
| Gene | Function | Regulation in ΔUSF2 | Impact |
|---|---|---|---|
| Pink1 | Mitophagy initiation | Upregulated | Enhanced mitochondrial clearance |
| Mfn2 | Mitochondrial fusion | Upregulated | Altered morphology |
| Pdk4 | Glucose metabolism | Upregulated | Metabolic reprogramming |
| Lamp1 | Lysosomal function | Upregulated | Increased lysosomal activity |
USF2 (Upstream Stimulatory Factor 2) is a transcription factor belonging to the basic helix-loop-helix leucine zipper family. It functions as a critical regulator of gene expression by binding to E-box motifs in target gene promoters. USF2 is also known by several alternative names including BHLHB12 (Class B basic helix-loop-helix protein 12), FIP (c-fos interacting protein), and Major late transcription factor 2 . With a calculated molecular weight of approximately 37 kDa (though observed at approximately 44 kDa in Western blot analyses), USF2 plays significant roles in cellular processes including glucose metabolism, stress response, and cell cycle regulation . Its importance in research stems from its involvement in various physiological and pathological processes, making it a valuable target for studies on transcriptional regulation.
There are several types of USF2 antibodies available for research applications, each with unique characteristics:
| Antibody Type | Host | Clone/ID | Immunogen | Validated Applications | Species Reactivity |
|---|---|---|---|---|---|
| Polyclonal | Rabbit | NBP2-58499 | Recombinant protein with sequence: GPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTI | ICC/IF | Human |
| Monoclonal | Mouse | 5F2 | USF2 (NP_003358, 1-100 a.a.) partial recombinant protein with GST tag | ELISA, ICC/IF, IHC, IHC-P, Sandwich ELISA, WB | Human, Rat |
| Monoclonal | Mouse | PCRP-USF2-1A7 | Recombinant fragment (aa220-346) of human USF2 protein | Flow Cytometry, ICC/IF, IHC-P | Human |
| Polyclonal | Rabbit | 16614-1-AP | USF2 fusion protein | WB, IHC, ELISA | Human, Mouse, Rat |
The choice between polyclonal and monoclonal antibodies depends on the specific research requirements. Polyclonal antibodies recognize multiple epitopes, potentially offering higher sensitivity but with increased risk of cross-reactivity. Monoclonal antibodies target a single epitope, providing greater specificity but potentially lower signal strength .
Proper storage of USF2 antibodies is crucial for maintaining their activity and specificity. Based on manufacturer recommendations:
For short-term storage (less than one month), USF2 antibodies should be stored at 4°C . For long-term preservation, aliquoting the antibody and storing at -20°C or -80°C is recommended to prevent degradation . It is essential to avoid repeated freeze-thaw cycles as they can compromise antibody functionality and lead to protein denaturation .
The specific storage buffer varies between products but typically includes PBS (pH 7.2-7.4) with additives such as glycerol (e.g., 40% glycerol) and sometimes BSA (0.05%) to enhance stability . Some formulations may contain sodium azide (0.02%) as a preservative, though azide-free versions are available for applications where azide might interfere with experimental results .
Optimizing antibody dilutions is critical for achieving reliable and reproducible results. Recommended dilutions vary by application and specific antibody:
| Application | Recommended Dilution Ranges | Optimization Strategy |
|---|---|---|
| Western Blot | 1:500-1:2000 | Begin with manufacturer's recommended dilution (e.g., 1:1000). Perform a dilution series if needed, adjusting based on signal-to-noise ratio. |
| Immunocytochemistry/Immunofluorescence | 1-4 μg/mL | Start with 1-2 μg/mL and adjust based on signal intensity and background. |
| Immunohistochemistry (Paraffin) | 1-2 μg/mL | Initial testing at recommended concentration with subsequent optimization based on tissue type. |
| Flow Cytometry | 1-2 μg/million cells | Begin with manufacturer's recommendation, then adjust based on population separation and staining intensity. |
When optimizing, consider including appropriate positive and negative controls to validate specificity. The dilution should be experimentally determined for each new experimental system, as factors such as protein expression levels and sample preparation methods can affect optimal antibody concentration .
Effective blocking is essential for reducing non-specific binding and improving signal-to-noise ratio. For USF2 antibody applications:
In Western blot protocols, 5% non-fat dry milk or 3-5% BSA in TBST (Tris-buffered saline with 0.1% Tween-20) is typically effective for blocking. For phospho-specific detection, BSA is preferred over milk as milk contains phosphoproteins that may interfere with detection.
For immunohistochemistry and immunocytochemistry, 5-10% normal serum from the same species as the secondary antibody provides effective blocking. Alternatively, 1-3% BSA can be used.
When troubleshooting high background issues, consider:
Extending blocking time (from 1 hour to overnight at 4°C)
Adding 0.1-0.3% Triton X-100 to permeabilize cells more effectively in ICC/IF applications
Including 0.1-0.3% Tween-20 in washing buffers to reduce non-specific interactions
These parameters should be optimized based on the specific USF2 antibody being used and the particular experimental system .
Inconsistent detection of USF2 in Western blot can stem from several factors. A systematic troubleshooting approach includes:
Protein Extraction and Sample Preparation:
USF2 is a nuclear transcription factor, so ensure nuclear extraction protocols are effective
Include protease inhibitors in lysis buffers to prevent degradation
Optimize sample denaturation conditions (temperature and duration)
Technical Considerations:
The observed molecular weight of USF2 is approximately 44 kDa, which may differ from the calculated weight of 37 kDa due to post-translational modifications
Use freshly prepared samples when possible, as USF2 may degrade during storage
Consider gradient gels (4-15%) to improve separation in the 35-50 kDa range
Antibody-Specific Factors:
Different USF2 antibodies recognize distinct epitopes; the monoclonal 5F2 clone targets the N-terminal region (amino acids 1-100) , while other antibodies target different regions
If one antibody yields inconsistent results, validate with an alternative antibody targeting a different epitope
Optimize primary antibody incubation (overnight at 4°C often yields better results than shorter incubations)
When troubleshooting, include positive control lysates from cells known to express USF2, such as Jurkat or HepG2 cells, which have been confirmed to express detectable levels of USF2 .
Rigorous validation of antibody specificity is essential for reliable research outcomes. For USF2 antibodies, recommended validation strategies include:
Genetic Approaches:
Knockdown/knockout validation: Compare staining patterns in USF2 knockout/knockdown cells with wild-type cells. Published studies have utilized this approach for USF2 antibody validation
Overexpression validation: Test antibody reactivity in cells overexpressing tagged USF2
Biochemical Validations:
Peptide competition assays: Pre-incubate the antibody with the immunizing peptide to confirm signal reduction in positive samples
Cross-reactivity testing: The Novus Biologicals USF2 antibody specificity has been verified against a protein array containing the target protein plus 383 other non-specific proteins
Application-Specific Controls:
For IHC/ICC: Include isotype controls using non-specific IgG from the same species as the primary antibody
For Western blot: Run ladders to confirm molecular weight (expected around 44 kDa) and include both positive control samples (e.g., Jurkat cells, HepG2 cells) and negative controls
Technical Validation:
Confirm reproducibility across different lots of the same antibody
Validate across multiple applications (e.g., if an antibody works in Western blot, confirm findings with IHC or ICC)
These validation steps are especially important when studying USF2 in novel experimental systems or when investigating new functional aspects of this transcription factor.
While not explicitly mentioned in the search results, ChIP is a common application for transcription factor antibodies like USF2. Optimizing ChIP with USF2 antibodies requires:
Antibody Selection:
Select antibodies validated for immunoprecipitation applications
Polyclonal antibodies often perform better in ChIP due to their recognition of multiple epitopes
Consider epitope accessibility in the chromatin context; antibodies targeting regions involved in DNA binding may be less effective
Protocol Optimization:
Chromatin fragmentation: Optimize sonication conditions to achieve fragments of 200-500 bp
Cross-linking: For transcription factors like USF2, dual cross-linking with both formaldehyde (1%) and protein-protein cross-linkers (such as DSG) may improve efficiency
Antibody amount: Start with 2-5 μg of antibody per ChIP reaction, and optimize based on results
Quality Control:
Validate enrichment using qPCR primers for known USF2 binding sites before proceeding to sequencing
Include input controls, IgG controls, and positive controls targeting abundant histone marks
Consider spike-in normalization approaches for quantitative comparisons between conditions
Data Analysis:
Focus on E-box motifs (CACGTG) when analyzing USF2 ChIP-seq data, as these are known binding sites for USF2
Compare USF2 binding profiles with RNA-seq data to correlate binding with gene expression changes
These recommendations are based on general ChIP best practices for transcription factors, applied specifically to USF2 research contexts.
USF1 and USF2 are related transcription factors that can form both homodimers and heterodimers, making their distinct functions challenging to study. Key experimental approaches to distinguish their activities include:
Differential Antibody Targeting:
Use highly specific antibodies that do not cross-react between USF1 and USF2
Validate specificity through Western blot analysis of recombinant USF1 and USF2 proteins
Sequential ChIP (Re-ChIP):
Perform sequential immunoprecipitation with USF1 and USF2 antibodies to identify sites bound by heterodimers versus homodimers
Compare with single-factor ChIP to create a comprehensive binding profile
Selective Gene Knockdown:
Use siRNA or CRISPR approaches targeting either USF1 or USF2 specifically
Analyze differential effects on target gene expression and cellular phenotypes
Rescue experiments with overexpression of one factor in the absence of the other
Protein-Protein Interaction Studies:
Use co-immunoprecipitation with USF2 antibodies to identify unique interaction partners
Compare interactomes of USF1 and USF2 to identify factor-specific regulatory complexes
When designing experiments to distinguish USF1 and USF2 functions, it's important to note their different molecular weights (USF1: approximately 43 kDa; USF2: approximately 44 kDa) and to select antibodies raised against non-conserved regions of these proteins to ensure specificity .
USF2 expression and function vary across tissues, necessitating tailored approaches for detection:
Tissue Expression Patterns:
USF2 is widely expressed but shows variable levels across tissues
Higher expression is typically observed in actively proliferating cells
Tissue-Specific Optimization for IHC/IF:
Antigen retrieval methods may need adjustment based on tissue type:
For formalin-fixed tissues: Heat-induced epitope retrieval using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0)
For highly cross-linked tissues: Consider extending retrieval time
Background reduction strategies differ by tissue:
For tissues with high endogenous peroxidase activity: More thorough peroxidase blocking
For tissues with high biotin content: Avidin-biotin blocking may be necessary
Sample Preparation Considerations:
Nuclear extraction efficiency varies by tissue type and may require protocol modifications
For Western blot applications with tissue lysates, additional optimization of lysis buffers may be needed compared to cell line protocols
Validation in Tissue Context:
Include known positive control tissues when establishing new protocols
The mouse anti-USF2 monoclonal antibody (5F2) has been validated on human esophagus tissue sections, which can serve as a positive control
These tissue-specific considerations are particularly important when studying USF2 in primary tissues rather than established cell lines, as fixation methods, protein expression levels, and background signals can vary significantly.
USF2 antibodies enable sophisticated investigations of transcriptional networks through several cutting-edge approaches:
Integrated Multi-Omics Approaches:
ChIP-seq with USF2 antibodies can be integrated with ATAC-seq, RNA-seq, and proteomics data to create comprehensive regulatory network maps
Sequential ChIP using USF2 antibodies together with antibodies against other transcription factors or chromatin modifiers can identify cooperative regulatory complexes
Single-Cell Applications:
Adapting USF2 antibodies for CUT&Tag or CUT&RUN protocols enables profiling of USF2 binding in limited sample material
Single-cell immunofluorescence using validated USF2 antibodies can reveal cell-to-cell variability in USF2 expression and localization
Proximity Labeling Approaches:
Coupling USF2 antibodies with proximity labeling techniques (e.g., BioID or APEX2) can identify novel interaction partners and reveal the composition of USF2-containing regulatory complexes
These approaches can uncover context-specific interactions in different cell types or under various stimuli
Functional Genomics Integration:
CRISPR screens targeting USF2 binding sites identified through ChIP-seq can systematically assess the functional importance of different USF2-regulated elements
Correlating these functional data with binding profiles determined using USF2 antibodies can prioritize key regulatory nodes
When designing these advanced studies, researchers should ensure rigorous validation of the selected USF2 antibody for the specific application and consider the epitope location relative to functional domains that may be engaged in protein-protein or protein-DNA interactions.
Post-translational modifications (PTMs) regulate USF2 function, and their study requires specialized approaches:
Modification-Specific Antibodies:
While the search results don't mention USF2 PTM-specific antibodies, researchers can:
Use general PTM antibodies (phospho-Ser/Thr/Tyr, acetyl-Lys, etc.) after USF2 immunoprecipitation
Consider custom antibody development for specific, confirmed USF2 modification sites
Mass Spectrometry Approaches:
Immunoprecipitate USF2 using validated antibodies (such as those described in the search results) followed by mass spectrometry analysis
Compare PTM profiles under different cellular conditions to identify regulatory modifications
Functional Validation of PTMs:
Generate site-specific mutants (e.g., phospho-mimetic or phospho-deficient) and compare their function to wild-type USF2
Use specific kinase/phosphatase inhibitors to manipulate modification status and assess impacts on USF2 function
Cellular Context Considerations:
PTM patterns may vary significantly across cell types and stimuli
When designing experiments, consider time-course analyses after cellular stimulation to capture dynamic modification changes
Technical Considerations:
Include phosphatase/deacetylase inhibitors in lysis buffers when studying phosphorylation or acetylation
For Western blot detection of modified forms, Phos-tag™ gels or other mobility shift approaches may help resolve modified USF2 variants
These approaches enable researchers to connect USF2 post-translational modifications to functional outcomes in different biological contexts.
Several emerging technologies are expanding the utility of USF2 antibodies in research:
Spatial Transcriptomics Integration:
Combining immunofluorescence using USF2 antibodies with spatial transcriptomics techniques provides insights into spatial relationships between USF2 localization and gene expression patterns
These approaches are particularly valuable for understanding tissue-specific USF2 functions in heterogeneous samples
Live-Cell Imaging Approaches:
While traditional antibodies cannot access intracellular proteins in living cells, derivative technologies such as nanobodies or intrabodies based on USF2-specific binding domains may enable live-cell tracking of USF2 dynamics
These approaches could reveal previously unappreciated aspects of USF2 localization and trafficking
Antibody Engineering for Enhanced Properties:
Recombinant antibody technologies allow for engineering of USF2 antibodies with improved properties
Site-specific conjugation of fluorophores or other functional moieties can enhance detection sensitivity and expand application possibilities
High-Throughput and Automated Platforms:
Adaptation of USF2 antibodies to automated immunostaining platforms enables consistent results across large sample sets
Integration with digital pathology and machine learning analysis can extract deeper insights from USF2 immunostaining patterns
These technological advances will likely expand our understanding of USF2 biology and provide new tools for investigating its roles in normal physiology and disease states.
When faced with contradictory results from different USF2 antibodies, researchers should implement a systematic approach to resolve discrepancies:
Epitope Mapping and Antibody Characterization:
Determine the exact epitopes recognized by each antibody
The polyclonal antibody from Novus Biologicals targets a sequence in USF2 protein , while the monoclonal 5F2 targets amino acids 1-100 , and the PCRP-USF2-1A7 recognizes amino acids 220-346
Epitope differences may explain detection discrepancies if protein conformation, interactions, or modifications affect epitope accessibility
Validation Strategy Comparison:
Assess the validation methods used for each antibody
Cross-reference with genetic approaches (siRNA knockdown, CRISPR knockout) to determine which antibody most accurately reflects USF2 biology
Technical Parameter Evaluation:
Compare protocols, including fixation methods, antigen retrieval approaches, and detection systems
Standardize conditions and perform side-by-side comparisons with all antibodies
Isoform Consideration:
Determine if contradictory results might stem from differential detection of USF2 isoforms
Consult RNA-seq data for the experimental system to identify which isoforms are expressed
Expert Consensus Approach:
When discrepancies persist, consider a consensus approach using multiple antibodies
Results consistent across different antibodies targeting distinct epitopes likely reflect true USF2 biology
Transparency in reporting all validation steps and acknowledging limitations of specific antibodies is essential for advancing USF2 research and ensuring reproducibility across laboratories.