VP3 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to VP3 Antibody

VP3 antibodies are immunoglobulins targeting the VP3 protein, a structural component of various viruses, including Birnaviridae, Polyomaviridae, and Picornaviridae. These antibodies play critical roles in viral neutralization, diagnostic assays, and vaccine development. VP3 is often involved in viral assembly, genome packaging, and host immune evasion, making it a key target for therapeutic and diagnostic applications .

Diagnostic Applications of VP3 Antibodies

VP3 antibodies are widely used in immunoassays for detecting viral infections. Notable examples include:

3.1. Goose Parvovirus (GPV) Antibody Detection

A VP3 peptide-based ELISA was developed using antigenic domains (Table 1) :

Peptide IDSequence (aa)Homology (GPV Strains)Reactivity (OD₄₅₀)
VP3-1 (358–392)VTDEQEVAPTNGVGWKPYGKTVTNEQNTTTAPTSS97.2–100%1.82 ± 0.12
VP3-2 (485–509)LRKENSKRWNPEIQFTSNFSDRTSI96.2–100%0.94 ± 0.08
VP3-3 (111–130)FKIFNVQVKEVTTQDQTKTI100%1.21 ± 0.10

Performance Metrics:

  • Specificity: No cross-reactivity with NDV, AIV, or other pathogens .

  • Sensitivity: 100% detection rate in immunized geese, outperforming agar gel precipitation (84.17%) .

3.2. Hepatitis A Virus (HAV) Detection

Mouse monoclonal anti-HAV VP3 antibody (clone 1881) recognizes a neutralizing epitope with:

  • Purity: >90% by SDS-PAGE .

  • Application: Immunoassays for HAV diagnosis and vaccine efficacy monitoring .

4.1. Enterovirus 71 (EV71) Neutralization

The IgG antibody 5H7 targets a conformational VP3 epitope in EV71, showing:

  • Neutralization titer (NT₅₀): 80 .

  • In vivo efficacy: 100% survival rate in AG129 mice post-lethal challenge .

4.2. Broad-Spectrum Epitope Identification

A conserved VP3 epitope (82FxRFHxH88) in Waterfowl Parvovirus (WPV) was mapped using mAb 4A6 :

  • Epitope validation: Phage display and peptide ELISA confirmed binding specificity .

  • Functional impact: Disruption of this epitope reduced antibody neutralization by 90% .

5.1. VP3 Epitope Mapping in WPV

  • Critical residues: Phe82 and His88 are essential for mAb 4A6 binding .

  • Conservation: 100% homology across 11 GPV and 2 Muscovy duck parvovirus strains .

5.2. Dynamic Antibody Responses

Post-vaccination studies in geese revealed:

  • Peak antibody levels: 22 days post-immunization (Figure 1) .

  • Detection threshold: Antibodies detectable by day 8 .

Comparative Analysis of VP3 Antibody Platforms

PlatformTarget VirusSensitivitySpecificityApplication
Peptide ELISA (VP3-1)GPV100%100%Vaccine monitoring
AGP TestGPV84.17%ModerateField diagnostics
mAb 4A6 (Epitope)WPVHighHighEpitope-based vaccines
mAb 5H7 (IgG)EV71NT₅₀ = 80HighTherapeutic neutralization

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (12-14 weeks)
Synonyms
VP3 antibody; Apoptin antibody
Target Names
VP3
Uniprot No.

Target Background

Function
VP3 Antibody may function as a transcriptional regulator. It induces apoptosis in infected cells and is a key component of the infectious replication cycle.
Protein Families
Gyrovirus apoptin family
Subcellular Location
Host nucleus. Note=Host nucleus of infected cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.