VP3 antibodies are immunoglobulins targeting the VP3 protein, a structural component of various viruses, including Birnaviridae, Polyomaviridae, and Picornaviridae. These antibodies play critical roles in viral neutralization, diagnostic assays, and vaccine development. VP3 is often involved in viral assembly, genome packaging, and host immune evasion, making it a key target for therapeutic and diagnostic applications .
VP3 antibodies are widely used in immunoassays for detecting viral infections. Notable examples include:
A VP3 peptide-based ELISA was developed using antigenic domains (Table 1) :
| Peptide ID | Sequence (aa) | Homology (GPV Strains) | Reactivity (OD₄₅₀) |
|---|---|---|---|
| VP3-1 (358–392) | VTDEQEVAPTNGVGWKPYGKTVTNEQNTTTAPTSS | 97.2–100% | 1.82 ± 0.12 |
| VP3-2 (485–509) | LRKENSKRWNPEIQFTSNFSDRTSI | 96.2–100% | 0.94 ± 0.08 |
| VP3-3 (111–130) | FKIFNVQVKEVTTQDQTKTI | 100% | 1.21 ± 0.10 |
Specificity: No cross-reactivity with NDV, AIV, or other pathogens .
Sensitivity: 100% detection rate in immunized geese, outperforming agar gel precipitation (84.17%) .
Mouse monoclonal anti-HAV VP3 antibody (clone 1881) recognizes a neutralizing epitope with:
The IgG antibody 5H7 targets a conformational VP3 epitope in EV71, showing:
A conserved VP3 epitope (82FxRFHxH88) in Waterfowl Parvovirus (WPV) was mapped using mAb 4A6 :
Epitope validation: Phage display and peptide ELISA confirmed binding specificity .
Functional impact: Disruption of this epitope reduced antibody neutralization by 90% .
Critical residues: Phe82 and His88 are essential for mAb 4A6 binding .
Conservation: 100% homology across 11 GPV and 2 Muscovy duck parvovirus strains .
Post-vaccination studies in geese revealed: