The term "C35A5.10 Antibody" does not appear in the provided search results or widely recognized databases. Potential misinterpretations include:
Typographical Errors: Possible confusion with identifiers like SLC35A5 (solute carrier family 35 member A5) or C10orf53 (chromosome 10 open reading frame 53), which are targets of validated antibodies.
Proprietary Designations: "C35A5.10" may refer to an internal catalog number or experimental antibody not yet published.
While "C35A5.10" is not documented, insights can be drawn from analogous antibodies:
Target: SLC35A5, a nucleotide sugar transporter.
Applications: Immunohistochemistry (IHC) and immunoblotting (IB).
Validation: Tested across 44 normal human tissues and 20 cancer types via the Human Protein Atlas (HPA) .
| Parameter | Detail |
|---|---|
| Immunogen | TLQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARV (partial sequence) |
| Species Reactivity | Human |
| Techniques | IHC (1:50–1:200), IB (0.04–0.4 μg/mL) |
Target: C10orf53, a poorly characterized protein.
Applications: IHC and IB for subcellular localization studies .
| Parameter | Detail |
|---|---|
| Immunogen | MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEEVIFHCNIKDLEF |
| Species Reactivity | Human |
| Techniques | IHC (1:200–1:500), IB (0.04–0.4 μg/mL) |
No data exists in the provided sources for "C35A5.10 Antibody." Critical missing information includes:
Target Specificity: No validated antigen or epitope data.
Structural Design: Unknown if it is monoclonal, polyclonal, or engineered (e.g., bispecific).
Functional Data: No efficacy studies, binding kinetics, or clinical trial references.
Verify Nomenclature: Confirm the antibody’s official name or catalog number.
Explore Proprietary Sources: Check manufacturer catalogs (e.g., Genovis, Antibody Research Corporation) for unpublished antibodies .
Leverage Analogous Targets: Study SLC35A5 or C10orf53 antibodies for methodological insights .
C35A5.10 Antibody is a monoclonal antibody developed for specific target recognition in immunological research applications. While specific information about this particular antibody designation is limited in the provided sources, monoclonal antibodies generally function through highly specific epitope recognition via their complementarity-determining regions (CDRs).
The primary research applications for monoclonal antibodies like C35A5.10 typically include:
Western blotting (WB) for protein detection in cell or tissue lysates
Immunohistochemistry (IHC) for tissue localization studies
Flow cytometry for cell surface marker identification
Immunoprecipitation for protein isolation and purification
ELISA for quantitative antigen detection
As with other monoclonal antibodies, validation is critical before experimental use. For example, anti-c-Fos antibodies undergo validation for Western blot and immunohistochemistry applications and are tested against specific species samples like human and rat tissues . When selecting C35A5.10 for any application, researchers should carefully review validation data demonstrating specificity for their particular experimental system and target.
Before implementing C35A5.10 in research protocols, comprehensive validation is essential to ensure experimental reliability. Based on standard antibody validation practices, the following approaches should be considered:
Specificity testing: Verify target recognition using positive and negative controls, including knockout/knockdown models where available.
Cross-reactivity assessment: Test against related proteins to ensure specific target binding.
Application-specific validation: Confirm performance in each intended application (WB, IHC, flow cytometry).
Batch-to-batch consistency: Test each lot against reference standards to ensure consistent performance.
Species reactivity verification: Confirm reactivity with target proteins from specific species of interest.
For example, when validating monoclonal antibodies like the anti-c-Fos antibody, researchers observe molecular weight bands higher than predicted (62 kDa instead of 41 kDa) due to post-translational modifications . This highlights the importance of understanding the expected characteristics of your target protein. Similarly, antibodies against viral targets like dengue require validation through neutralization assays to confirm functional activity beyond mere binding .
Proper storage is critical for maintaining antibody functional integrity and preventing degradation. For optimal preservation of C35A5.10 Antibody activity, follow these evidence-based storage guidelines:
Temperature: Store at -20°C for long-term preservation. Most commercial antibodies are shipped at 4°C but should be stored frozen upon arrival.
Aliquoting: Divide into small, single-use aliquots to minimize freeze-thaw cycles, which can significantly degrade antibody function.
Buffer composition: For storage, most antibodies perform best in buffers containing:
Phosphate Buffered Saline (pH 7.4)
50% Glycerol (cryoprotectant)
0.09% Sodium Azide (preservative)
Freeze-thaw avoidance: Limit to fewer than 5 cycles to prevent denaturation and aggregation.
Commercial antibodies like anti-c-Fos are typically supplied in this type of stabilizing buffer formulation and shipped at 4°C with recommendations to store at -20°C upon delivery . For C35A5.10, following similar protocols would likely optimize stability and performance across experiments.
Optimal dilution ranges for C35A5.10 Antibody would vary by application based on antibody concentration, affinity, and experimental conditions. While specific dilutions for C35A5.10 are not provided in the search results, standard recommendations for monoclonal antibodies can serve as starting points:
| Application | Typical Dilution Range | Optimization Approach |
|---|---|---|
| Western Blot | 1:500 - 1:5,000 | Begin with 1:1,000 and adjust based on signal intensity and background |
| Immunohistochemistry | 1:50 - 1:500 | Start with 1:100 for paraffin sections |
| Flow Cytometry | 1:50 - 1:200 | Initial test at 1:100 with titration as needed |
| ELISA | 1:1,000 - 1:10,000 | Determine through checkerboard titration |
| Immunoprecipitation | 1:50 - 1:200 | Optimize based on pull-down efficiency |
As seen with other monoclonal antibodies in the search results, specific recommended dilutions vary by application - for instance, anti-c-Fos antibody is recommended at 1:1,000 for Western blotting and 1:100 for immunohistochemistry . For C35A5.10, researchers should perform dilution series experiments to determine optimal concentrations for their specific experimental conditions.
Epitope specificity is a fundamental characteristic that shapes experimental design when working with C35A5.10 or any monoclonal antibody. Understanding the specific epitope recognized by C35A5.10 is critical for:
Accessibility considerations: If the epitope is conformational, denaturation during techniques like Western blotting may affect recognition. Conversely, if the epitope is linear, the antibody may perform well in applications with denatured proteins.
Cross-reactivity assessment: Epitope conservation across species or within protein families can predict potential cross-reactivity that must be controlled for.
Multiplexing potential: Knowledge of the epitope location helps determine compatibility with other antibodies targeting the same protein for co-labeling experiments.
Functional implications: Epitopes in functional domains may enable the antibody to block protein activity, relevant for neutralization studies.
As demonstrated with antibodies like 3H5 and 2C8 against dengue virus, epitope specificity dramatically affects functional properties—these antibodies bind different epitopes on the same viral protein, with 3H5 showing significantly different pH-dependent binding characteristics and neutralization mechanisms compared to 2C8 . Similarly, for C35A5.10, researchers should determine whether the recognized epitope is accessible under their experimental conditions and how this affects data interpretation.
pH sensitivity is a critical factor affecting antibody binding kinetics that can significantly impact experimental results. For C35A5.10 Antibody, understanding pH-dependent binding characteristics is essential for optimizing protocols, particularly for applications involving pH changes like endosomal trafficking studies or immunoprecipitation with elution steps.
Research on other monoclonal antibodies provides important insights into pH effects. For example, the dengue virus-targeting antibodies 2C8 and 3H5 show markedly different pH-dependent binding profiles despite similar neutralization potency. 3H5 demonstrates remarkably resilient binding under acidic endosomal pH conditions, while 2C8 shows reduced binding at lower pH . This pH-dependent binding directly correlates with their different functional outcomes.
For C35A5.10, researchers should:
Characterize binding at different pH values: Perform surface plasmon resonance (SPR) measurements across a pH range (typically pH 5.0-8.0) to establish a pH-binding profile.
Measure association and dissociation kinetics: Determine k₁ (association) and k₋₁ (dissociation) rates at different pH values to identify pH-sensitive binding steps.
Correlate with functional outcomes: Assess whether pH-dependent binding affects functional assays relevant to your research.
Optimize buffer systems: Based on pH profiling, select buffer systems that maximize binding efficiency for specific applications.
Understanding these pH-dependent characteristics can significantly improve experimental design and interpretation of results when working with C35A5.10 Antibody in complex biological systems.
Modern computational tools offer powerful methods to predict antibody binding characteristics and optimize experimental design. For C35A5.10 Antibody, researchers can leverage several computational approaches:
Epitope prediction algorithms: Tools like Antibody i-Patch, Paratome, and machine learning algorithms including proABC, Parapred, and Antibody Interface Prediction can predict CDR-paratope interactions .
Antigen-antibody docking simulations: Programs such as ClusPro, SurFit, FRODOCK, and SnugDock can model the structural interaction between C35A5.10 and its target, providing insights into binding orientation and contact residues .
Affinity maturation simulation: Computational mutagenesis of CDR regions, particularly CDR3, can identify potential modifications to enhance binding affinity, improving experimental sensitivity .
Developability assessment: In silico screening for liabilities like unpaired cysteines, deamidation hotspots, or motifs associated with non-specific binding can predict potential experimental issues .
These computational approaches offer significant advantages:
Reduction in experimental iterations required for optimization
Identification of potential cross-reactivity issues before experimentation
Prediction of optimal conditions for specific applications
Guidance for antibody engineering to improve performance characteristics
By integrating these computational methods into your research workflow, you can significantly enhance the efficiency and effectiveness of experiments utilizing C35A5.10 Antibody.
Strategic modification of C35A5.10 Antibody can significantly enhance its research utility for specialized applications. Several evidence-based approaches can be employed:
CDR walking for affinity enhancement: This technique involves sequential mutation of complementarity-determining regions (CDRs) followed by selection rounds. This approach has yielded remarkable results, such as:
Fc engineering for functional modulation: Modification of the Fc region can alter antibody functional properties:
LALA mutations can eliminate Fc receptor binding to prevent unwanted cellular activation
Strategic glycoengineering can enhance or reduce effector functions
Fc modifications can extend half-life for long-term experiments
Conjugation strategies for detection and targeting:
Site-specific conjugation to fluorophores for higher sensitivity in imaging
Enzyme conjugation (HRP, AP) for enhanced detection in immunoassays
Biotin conjugation for versatile detection systems and pull-down assays
Fragment generation for improved tissue penetration:
Fab fragments for reduced steric hindrance in dense tissues
scFv constructs for applications requiring small antibody formats
In research scenarios requiring both potent neutralization and minimal antibody-dependent enhancement (ADE), modifications similar to those demonstrated with the 3H5 antibody against dengue virus might be considered. This antibody maintains potent neutralization while showing dramatically reduced ADE , a property that could be valuable for certain C35A5.10 applications.
When faced with contradictory results using C35A5.10 Antibody, systematic troubleshooting through multiple methodologies is essential. Implement these evidence-based approaches to resolve discrepancies:
Cross-validation with orthogonal methods:
Confirm target detection using alternative antibodies recognizing different epitopes
Validate with non-antibody methods (e.g., mass spectrometry, CRISPR-Cas9 knockout)
Compare results across multiple detection platforms (e.g., flow cytometry, Western blot, IHC)
Binding kinetics assessment:
Perform surface plasmon resonance (SPR) to quantify affinity under various conditions
Analyze association and dissociation rates at different temperatures and pH values
Compare binding parameters between experimental conditions showing discrepancies
Epitope accessibility investigation:
Assess target protein conformation in different sample preparation methods
Evaluate epitope masking by interacting proteins or post-translational modifications
Consider native versus denatured protein recognition differences
Controls for non-specific interactions:
Implement isotype controls matching C35A5.10's isotype class
Use knockout/knockdown models as definitive negative controls
Include competitive binding assays with unconjugated antibody
Biological variability assessment:
Evaluate cell-type or tissue-specific expression patterns
Consider differential protein isoform expression
Assess influence of cell activation state or differentiation stage
For example, when characterizing antibodies against dengue virus, researchers performed both pre- and post-attachment neutralization assays to determine if antibodies functioned by blocking receptor binding or post-entry mechanisms . Similar mechanistic studies can help resolve contradictory results with C35A5.10 by identifying condition-specific effects.
Post-translational modifications (PTMs) can significantly impact C35A5.10 Antibody target recognition, potentially altering experimental outcomes. Understanding these effects is crucial for accurate data interpretation and protocol optimization:
Phosphorylation effects:
Phosphorylation near the antibody epitope can enhance or inhibit binding
Phosphorylation states may vary with cell cycle, activation, or stress conditions
Time-course experiments may reveal dynamic recognition patterns
Glycosylation considerations:
N-linked and O-linked glycans can mask epitopes or create steric hindrance
Glycan composition varies between cell types and culture conditions
Enzymatic deglycosylation may be necessary for consistent detection
Ubiquitination and SUMOylation:
These modifications can alter protein conformation and epitope accessibility
They often signal for protein degradation, affecting target abundance
May create challenges in detecting low-abundance modified forms
Methodological approaches for PTM-aware detection:
| PTM Type | Detection Strategy | Controls/Validation |
|---|---|---|
| Phosphorylation | Phosphatase treatment comparison | Phospho-mimetic mutants |
| Glycosylation | PNGase F/O-glycosidase treatment | Tunicamycin-treated samples |
| Ubiquitination | Proteasome inhibitor treatment | K→R mutants at ubiquitination sites |
| Acetylation | HDAC inhibitor treatment | Acetylation-mimetic mutants |
The importance of understanding PTM effects is illustrated by the anti-c-Fos antibody, which detects a band at 62 kDa rather than the predicted 41 kDa due to post-translational modifications . Similar considerations apply to C35A5.10 target recognition, where unexpected band patterns or staining differences might be explained by differential PTMs across experimental conditions.
Successful multiplexing of C35A5.10 with other antibodies requires careful planning to avoid cross-reactivity, steric hindrance, and detection conflicts. Implement these evidence-based strategies for optimal multiplexed assays:
Epitope mapping and antibody compatibility:
Select antibodies targeting spatially distant epitopes to minimize steric interference
Choose antibodies from different host species to enable species-specific secondary detection
Verify that antibodies don't compete for the same binding site through competition assays
Sequential staining protocols:
For challenging multiplexing applications, implement sequential staining with complete washing between steps
Consider gentle elution of primary antibodies for serial detection on the same sample
Use direct conjugates for one target and indirect detection for others
Spectral separation strategies:
Select fluorophores with minimal spectral overlap for fluorescence applications
Implement computational spectral unmixing for closely overlapping fluorophores
Use quantum dots or narrow emission bandwidth fluorophores for demanding multiplexing
Cross-validation of multiplex results:
Compare multiplexed results with single-antibody controls to ensure sensitivity is maintained
Verify co-localization patterns with super-resolution techniques when possible
Include appropriate blocking steps to prevent non-specific binding
Advanced multiplexing technologies:
Consider tyramide signal amplification for sequential multiplexing with antibodies from the same species
Evaluate cyclic immunofluorescence for highly multiplexed imaging
Explore mass cytometry (CyTOF) for high-parameter analysis with metal-conjugated antibodies
For optimal results, perform titration of each antibody individually before combining them, as optimal concentrations may differ when used in combination due to buffer interactions or binding kinetics differences.
The field of antibody-based research is rapidly evolving with several emerging technologies that extend beyond traditional applications. For researchers working with C35A5.10 Antibody, these innovations offer new experimental possibilities:
Single-cell antibody sequencing: This technique enables isolation of antigen-specific memory B cells followed by single-cell sequencing to identify novel antibody sequences. As demonstrated in recent clinical trials for Staphylococcus aureus, this approach has led to the discovery of highly effective antibodies like IgG-6, which targets the pentameric form of Staphylococcus aureus protein A (SpA5) .
Ab initio antibody design: Computational tools like OptCDR, OptMAVEn, AbDesign, and RosettaAntibodyDesign now enable rational design of antibodies based on predicted antigen-antibody interfaces. These approaches leverage structural modeling to optimize binding characteristics even before experimental validation .
Developability-focused antibody engineering: Advanced screening approaches can identify and eliminate antibody sequences with liabilities like unpaired cysteines, deamidation hotspots, or motifs related to non-specific binding, improving experimental reliability and reproducibility .
Machine learning for binding prediction: The implementation of machine learning algorithms combined with computational mutagenesis of CDR3 regions now allows researchers to predict optimal antibody binding properties and guide experimental design .
Hot-spot grafting and re-epitoping: These novel approaches transfer binding site motifs from existing protein-protein complexes directly onto antibodies or test existing antibodies for binding capacities toward target epitopes, streamlining the development of highly specific research reagents .
These emerging technologies represent significant opportunities for researchers to enhance the utility of antibodies like C35A5.10 in their experimental workflows, enabling more precise detection, improved specificity, and novel applications in complex biological systems.
Maximizing reproducibility with C35A5.10 Antibody across different research groups requires systematic approaches to standardization and detailed documentation. Implement these evidence-based strategies to enhance cross-laboratory consistency:
Detailed reagent documentation:
Record complete antibody information including catalog number, lot number, and concentration
Document all validation data specific to the antibody and target
Maintain a centralized antibody database accessible to all collaborators
Standardized experimental protocols:
Develop detailed standard operating procedures (SOPs) with precise buffer compositions
Specify critical parameters such as incubation times, temperatures, and washing steps
Include troubleshooting guides for common issues
Quality control measures:
Implement regular antibody performance testing with reference standards
Use the same positive and negative controls across laboratories
Establish acceptance criteria for experimental validity
Systematic validation across systems:
Validate antibody performance in each cellular/tissue system before primary experiments
Document epitope accessibility in different sample preparation methods
Calibrate detection systems using standardized samples
Collaborative validation strategies:
Exchange samples between laboratories for blinded analysis
Implement round-robin testing of critical experiments
Conduct periodic teleconferences to discuss technical challenges
As demonstrated in antibody research for infectious diseases like dengue virus, where multiple validation approaches including binding affinity, neutralization potency, and Fc-receptor interactions were comprehensively assessed , thorough characterization and standardization are essential for reproducible results across different research environments.