SPAPB2B4.06 Antibody

What is SPAPB2B4.06 and what is its function in Schizosaccharomyces pombe?

SPAPB2B4.06 is a gene encoding an UPF0644 protein in Schizosaccharomyces pombe (fission yeast). According to the UniProt database (Q9HDW5), it functions as a UPF0644 family protein. The full-length protein consists of 256 amino acids with a sequence beginning with MGIASSLRLFGKAPASYLFNGFRRQMKNPLMKKGVVYAGVSGTCAAAGYMFNFVMEKHI and extending through the complete sequence . While its precise biological function remains under investigation, research suggests it may play a role in cellular processes specific to fission yeast. S. pombe serves as an excellent model organism for studying gene regulation due to its conserved regulatory processes and genetic features shared with metazoans .

How are antibodies against SPAPB2B4.06 validated for research applications?

Validation of SPAPB2B4.06 antibodies follows a rigorous multi-step process:

• Genetic approaches: Testing antibodies on knockout (KO) strains is considered the gold standard for validation. This involves comparing antibody detection between parental S. pombe strains and those with SPAPB2B4.06 gene deleted .

• Orthogonal validation: Using independent methods to confirm target expression, such as mass spectrometry or RNA-seq data, to correlate with antibody signals .

• Application-specific validation: Different experimental contexts require specific validation:

  • For Western blot: Confirming band size matches predicted molecular weight

  • For immunofluorescence: Comparing localization patterns in parental vs. KO strains

  • For immunoprecipitation: Verifying pulled-down proteins by mass spectrometry

Research data shows that antibodies validated using genetic approaches performed significantly better (80% success rate) compared to those validated using only orthogonal approaches, especially for immunofluorescence applications .

What experimental applications are compatible with SPAPB2B4.06 antibodies?

SPAPB2B4.06 antibodies can be employed in multiple experimental contexts depending on their validation status:

*Success rate depends on validation method: 38% for orthogonal validation, 80% for genetic validation

For S. pombe proteins like SPAPB2B4.06, recombinant antibodies generally showed higher performance compared to traditional monoclonal or polyclonal antibodies .

How can researchers address potential cross-reactivity of SPAPB2B4.06 antibodies?

Cross-reactivity remains a significant challenge in antibody-based experiments, particularly with yeast proteins. To address this issue:

• Epitope analysis: Compare the immunizing peptide sequence against the entire S. pombe proteome to identify potential cross-reactive proteins. The immunizing peptide for SPAPB2B4.06 should be assessed against similar UPF0644 family proteins .

• Parallel antibody testing: Use multiple antibodies raised against different epitopes of SPAPB2B4.06. Concordant results increase confidence in specificity .

• Negative controls: Always include samples from SPAPB2B4.06 knockout strains or RNAi-depleted cells .

• Competitive binding assays: Pre-incubate antibodies with excess purified target protein to block specific binding sites before application to samples .

• Database cross-referencing: Check antibody validation data from resources like YCharOS (https://ZENODO.org/communities/ycharos/) which publishes antibody characterization reports .

Research has shown that approximately 20-30% of published scientific figures are generated using antibodies that may not recognize their intended target, emphasizing the critical importance of proper validation .

What are the key differences between using polyclonal versus monoclonal antibodies against SPAPB2B4.06?

Data from large-scale antibody validation studies indicate that recombinant antibodies performed better than both monoclonal and polyclonal antibodies for detecting proteins in complex samples , making them potentially superior for detecting SPAPB2B4.06 in S. pombe extracts.

How can SPAPB2B4.06 antibodies be utilized in chromatin immunoprecipitation experiments?

For ChIP experiments using SPAPB2B4.06 antibodies, researchers should:

• Optimize crosslinking conditions: S. pombe cells typically require 1-3% formaldehyde for 5-15 minutes at room temperature.

• Consider cell wall digestion: Enzymatic treatment with zymolyase may improve nuclear extraction.

• Validate antibody specificity: ChIP-seq using a strain with tagged SPAPB2B4.06 (e.g., FLAG-tagged) alongside native antibody to confirm binding sites .

• Interpret binding patterns cautiously: Recent comprehensive ChIP-seq analysis of 80 S. pombe transcription factors revealed that binding patterns can be classified as:

  • "Common ubiquitous" regions (likely technical artifacts)

  • "Common frequent" regions (genuine binding sites)

  • Specific peak regions (unique binding sites)

• Use appropriate controls: Include an untagged strain and IgG control to identify non-specific binding regions.

Analysis of S. pombe ChIP-seq data shows that approximately one-third of gene promoters are bound by at least one transcription factor , providing context for interpreting potential SPAPB2B4.06 binding sites.

What is the recommended protocol for optimizing SPAPB2B4.06 antibody use in Western blotting?

For optimal Western blot results with SPAPB2B4.06 antibodies:

• Sample preparation:

  • Harvest S. pombe cells at mid-log phase (OD600 = 0.5-0.8)

  • Lyse cells using glass beads in buffer containing protease inhibitors

  • Add denaturing sample buffer and heat at 95°C for 5 minutes

• Gel electrophoresis and transfer:

  • Use 10-12% SDS-PAGE for optimal resolution

  • Transfer proteins to PVDF or nitrocellulose membranes using semi-dry transfer

  • Verify transfer efficiency with reversible protein stain

• Antibody incubation and detection:

  • Block membrane with 5% non-fat milk or BSA for 1 hour

  • Incubate with primary SPAPB2B4.06 antibody at 1:500-1:2000 dilution overnight at 4°C

  • Wash 3-5 times with TBST

  • Apply HRP-conjugated secondary antibody at 1:5000-1:10000 for 1 hour

  • Detect using enhanced chemiluminescence

• Controls:

  • Include SPAPB2B4.06 knockout strain as negative control

  • Use tagged SPAPB2B4.06 strain as positive control

  • Include loading control (e.g., Cdc2 detection using Y100 antibody)

How should researchers validate the specificity of SPAPB2B4.06 antibodies in immunofluorescence?

A comprehensive validation approach for immunofluorescence includes:

• Genetic validation:

  • Image a mosaic of parental and SPAPB2B4.06 knockout cells in the same field to reduce imaging and analysis biases

  • Compare signal intensity and localization patterns

• Optimization of fixation methods:

  • Test multiple fixation protocols (4% paraformaldehyde, methanol, or combined)

  • Optimize permeabilization conditions specific for S. pombe cell wall

• Dual labeling:

  • Co-stain with antibodies against proteins with known subcellular localization

  • For nuclear proteins, counterstain with DAPI as demonstrated in the GATA-6 antibody example

• Quantitative analysis:

  • Measure signal-to-noise ratio in positive vs. negative cells

  • Perform line-scan analysis to determine subcellular distribution

• Documentation and reporting:

  • Record all experimental parameters including antibody dilution, exposure times, and image processing methods

  • Document the specific S. pombe strain used (e.g., strain 972/ATCC 24843)

Data from the Antibody Characterization through Open Science (YCharOS) initiative revealed that 22% of antibodies used in published immunofluorescence studies were unable to immunolocalize their target proteins, with 88% of these studies containing no validation data .

What strategies are recommended for epitope mapping of SPAPB2B4.06 antibodies?

For comprehensive epitope mapping of SPAPB2B4.06 antibodies:

• Peptide array analysis:

  • Generate overlapping peptides (15-20 amino acids) spanning the entire SPAPB2B4.06 sequence

  • Spot peptides on membranes and probe with the antibody

  • Identify positive signals to narrow down the epitope region

• Deletion mutant analysis:

  • Create truncated versions of SPAPB2B4.06 protein

  • Express in a heterologous system or in vitro translation

  • Test antibody binding to identify the minimum region required

• Computational prediction and validation:

  • Use structural prediction tools like AlphaFold2 to model SPAPB2B4.06 3D structure

  • Predict surface-exposed regions likely to serve as epitopes

  • Validate predictions through competitive binding assays

• Cross-species reactivity testing:

  • Test antibody against homologous proteins from related species

  • Compare sequence conservation in regions recognized by the antibody

A successful epitope mapping approach was demonstrated for the SpA5 antibody, where researchers:

• Constructed 3D theoretical structures using AlphaFold2

• Used molecular docking to predict binding regions

• Validated the epitope by coupling keyhole limpet hemocyanin (KLH) to the predicted epitope

• Confirmed binding through ELISA and competitive binding assays

How can SPAPB2B4.06 antibodies be integrated into multi-omics research approaches?

SPAPB2B4.06 antibodies can be valuable components in multi-omics research strategies:

• Integrating proteomics and genomics:

  • Use SPAPB2B4.06 antibodies for immunoprecipitation followed by mass spectrometry (IP-MS) to identify protein interactors

  • Combine with ChIP-seq to map genomic binding sites if SPAPB2B4.06 has DNA-binding properties

  • Correlate with RNA-seq data to assess transcriptional impacts

• Spatial proteomics approaches:

  • Apply SPAPB2B4.06 antibodies in proximity labeling methods (BioID or APEX)

  • Identify proteins in close proximity to SPAPB2B4.06 in cellular compartments

• System-wide interaction mapping:

  • Include SPAPB2B4.06 antibodies in library-on-library screening approaches

  • Apply active learning algorithms to predict and validate additional interactions

• Data integration and visualization:

  • Submit validated data to databases like SAbDab (Structural Antibody Database)

  • Contribute to community resources like YCharOS for antibody validation

Recent research demonstrated that comprehensive strain libraries of endogenously tagged S. pombe proteins, combined with ChIP-seq and IP-MS approaches, can reveal extensive protein-protein interaction networks and regulatory mechanisms .

What troubleshooting approaches should be employed when SPAPB2B4.06 antibodies show inconsistent results?

When facing inconsistent results with SPAPB2B4.06 antibodies:

• Antibody quality assessment:

  • Check for degradation using SDS-PAGE followed by silver staining

  • Verify storage conditions (most antibodies should be stored at -20°C, avoiding repeated freeze-thaw cycles)

  • Consider using new lot or alternative vendor's antibody

• Sample preparation optimization:

  • Modify extraction methods to ensure target protein integrity

  • Add protease and phosphatase inhibitors to prevent degradation

  • Optimize cell lysis conditions specific for S. pombe

• Application-specific troubleshooting:

  • For Western blot: Adjust transfer conditions, blocking agents, and antibody dilutions

  • For IP: Modify buffer stringency to reduce non-specific binding

  • For IF: Test different fixation and permeabilization methods

• Validation with orthogonal methods:

  • Compare antibody results with tagged protein expression

  • Use RNA-seq or RT-PCR to confirm gene expression

  • Consider mass spectrometry to verify protein presence

• Documentation and standardization:

  • Maintain detailed records of all experimental parameters

  • Use Research Resource Identifiers (RRIDs) to track specific antibodies

  • Report all validation data when publishing results

Studies show that antibody performance can vary significantly across applications - an antibody that works well in Western blot may fail in immunofluorescence, making application-specific validation essential .

How can researchers leverage databases and computational tools for enhancing SPAPB2B4.06 antibody research?

Several databases and computational tools can support SPAPB2B4.06 antibody research:

• Antibody databases:

  • SAbDab (Structural Antibody Database): Contains antibody structures and annotations

  • PLAbDab (Patent and Literature Antibody Database): Provides literature-annotated antibody sequences

  • AACDB (Antigen-Antibody Complex Database): Offers insights into interaction interfaces

• Protein structure resources:

  • AlphaFold DB: Access predicted structures of SPAPB2B4.06 and its homologs

  • PomBase: Obtain S. pombe-specific protein information and functional annotations

• Epitope prediction tools:

  • BepiPred: Predict linear B-cell epitopes

  • DiscoTope: Identify discontinuous B-cell epitopes from protein structures

• Validation reporting platforms:

  • ZENODO/YCharOS: Community for sharing antibody characterization data

  • Antibody Registry: Assign and track Research Resource Identification numbers (RRIDs)

• Interactive analysis tools:

  • TFexplorer: Visualize transcription factor interactions in S. pombe

  • CiteAb: Quantify how antibodies have been used in literature

Analysis of antibody usage through CiteAb revealed that 31% of publications used underperforming antibodies for Western blot, 35% for immunoprecipitation, and 22% for immunofluorescence, highlighting the importance of consulting validation databases before selecting antibodies for research .

What emerging technologies are likely to enhance the utility of SPAPB2B4.06 antibodies in research?

Several cutting-edge technologies hold promise for enhancing SPAPB2B4.06 antibody applications:

• Single-cell proteomics:

  • Integration of SPAPB2B4.06 antibodies into microfluidic platforms

  • Analysis of protein expression at single-cell resolution in heterogeneous S. pombe populations

• Advanced imaging techniques:

  • Super-resolution microscopy for precise localization of SPAPB2B4.06

  • Live-cell imaging with fluorescently tagged nanobodies derived from SPAPB2B4.06 antibodies

• Proximity-based proteomics:

  • APEX2 or BioID fusion to SPAPB2B4.06 for identifying proximal proteins

  • Combined with mass spectrometry for comprehensive interaction mapping

• Rational antibody engineering:

  • Developing recombinant antibodies with enhanced specificity for SPAPB2B4.06

  • Single-cell RNA and VDJ sequencing for identifying optimized antibody sequences

• Active learning in experimental design:

  • Computational approaches to optimize antibody-antigen binding prediction

  • Reducing required experimental testing by 35% through machine learning algorithms

Recent advances in high-throughput single-cell sequencing of B cells have enabled rapid identification of antibodies with nanomolar affinity for specific antigens, a technology that could be applied to develop improved SPAPB2B4.06 antibodies .

What are the best practices for contributing SPAPB2B4.06 antibody validation data to the scientific community?

To maximize the value of SPAPB2B4.06 antibody research:

• Comprehensive validation reporting:

  • Document all validation methods (genetic, orthogonal, application-specific)

  • Include negative controls (knockout strains) and positive controls

  • Report all testing conditions, including unsuccessful attempts

• Data standardization:

  • Use Research Resource Identifiers (RRIDs) for all antibodies

  • Follow Minimum Information About an Antibody (MIAA) guidelines

  • Include lot numbers and storage/handling details

• Open data sharing:

  • Submit validation data to repositories like ZENODO/YCharOS

  • Contribute to antibody databases like Antibody Registry

  • Share detailed protocols on platforms like protocols.io

• Application-specific documentation:

  • For WB: Include full blot images, molecular weight markers, and loading controls

  • For IF: Provide unprocessed images with scale bars and counterstains

  • For IP-MS: Share complete datasets of identified proteins

• Integration with existing resources:

  • Link antibody data with PomBase for S. pombe-specific information

  • Connect to UniProt entries (Q9HDW5 for SPAPB2B4.06)

  • Contribute to community efforts like YCharOS' antibody characterization initiative