SPAC9.06c antibody is an IgG-class polyclonal antibody raised against recombinant SPAC9.06c protein from Schizosaccharomyces pombe (strain 972/ATCC 24843). It is designed for detecting the SPAC9.06c antigen in immunoassays such as ELISA and Western blot (WB) .
Target Protein: SPAC9.06c (UniProt ID: Q9UT22), a hypothetical protein in fission yeast with uncharacterized biological function.
The antibody is generated using a recombinant SPAC9.06c protein expressed in Escherichia coli. The immunogen sequence corresponds to the full-length SPAC9.06c protein, ensuring specificity to its target .
Validated for use in ELISA and WB to detect SPAC9.06c in fission yeast lysates .
Recommended dilution ranges:
WB: Optimal dilution determined empirically (typical range: 1:500–1:1000).
While SPAC9.06c’s biological role remains uncharacterized, fission yeast cell wall proteins like GPI-anchored proteins are critical for structural integrity and stress responses . This antibody could facilitate studies on:
Cell wall biosynthesis pathways.
Protein localization and interaction networks.
Limited Functional Data: No peer-reviewed studies directly linking SPAC9.06c to specific pathways or phenotypes were identified in the literature.
Cross-Reactivity: No cross-reactivity data with proteins from other species (e.g., Saccharomyces cerevisiae) is available.
Proteomic Profiling: Utilize this antibody in mass spectrometry-based studies to identify SPAC9.06c-interacting proteins.
Phenotypic Analysis: Investigate gene knockout strains to elucidate SPAC9.06c’s role in fission yeast biology.
Researchers typically employ both monoclonal and polyclonal antibodies for Cas9 detection. Monoclonal antibodies offer high specificity for particular epitopes, while polyclonal antibodies recognize multiple epitopes on the Cas9 protein. IgY polyclonal antibodies derived from immunized hens have emerged as a valuable option for detecting SpCas9 protein in biological samples. These can be rapidly isolated through a combination of yolk de-lipidation with pectin and protein salting out using ammonium sulfate . For researchers requiring highly specific detection, enzyme-linked immunosorbent assays (ELISAs) using anti-Cas9 antibodies have demonstrated effectiveness in detecting both SaCas9 and SpCas9 variants in human samples .
SpCas9-6xHis protein can be purified from the soluble fraction of transformed Escherichia coli BL21(DE3) bacteria using a one-step salting out procedure with ammonium sulfate (AmS) combined with immobilized metal affinity chromatography (IMAC). This method yields highly pure protein suitable for use as an antigen in antibody production protocols. The purified protein can then be used in immunization schemes with appropriate adjuvants to generate antibodies in animal models such as laying hens .
A standard one-month immunization schedule for laying hens includes:
Day 1: Initial immunization with 150 μg purified SpCas9-6xHis mixed with Freund's complete adjuvant (1:1 ratio), administered intramuscularly
Day 16: First boost with 150 μg SpCas9-6xHis mixed with Freund's incomplete adjuvant (1:1 ratio)
Day 23: Second boost with the same formulation as day 16
Day 28: Final blood collection for antibody isolation
Blood samples are typically collected before immunization (pre-immune) and at days 23 and 28 to monitor antibody production. Eggs are collected daily during the immunization period for IgY extraction .
The optimized protocol for IgY extraction involves two primary steps:
Lipid removal using pectin treatment
Fractional precipitation of proteins with ammonium sulfate
The highest yield of anti-SpCas9 IgY antibodies is typically found in the 35% ammonium sulfate precipitated fraction (P35%). This fraction shows the strongest signal for light and heavy IgY chains in immunodetection assays and the highest protein concentration among all collected fractions .
| Fraction | Relative Protein Concentration | Antibody Signal Strength |
|---|---|---|
| P35% (35% AmS precipitate) | Highest | Strong |
| S35% (35% AmS supernatant) | Medium | Moderate |
| P50% (50% AmS precipitate) | Medium-Low | Weak-Moderate |
| S50% (50% AmS supernatant) | Low | Weak |
Table 1: Relative distribution of IgY antibodies across different ammonium sulfate fractionation steps
Validation of anti-SpCas9 antibodies should include:
Western blot analysis: Testing against purified SpCas9 protein to confirm specific binding to light and heavy chains
Immunodetection in biological samples: Confirming the ability to detect SpCas9 in relevant biological contexts (e.g., Leishmania braziliensis promastigotes expressing exogenous SpCas9)
Negative controls: Confirming absence of signal in non-transfected cell lines or pre-immune sera
Cross-reactivity assessment: Testing against related Cas9 proteins from different bacterial species to determine specificity boundaries
Researchers should look for clear detection of the expected molecular weight bands (approximately 160 kDa for SpCas9) in samples known to express the protein while confirming absence of signal in appropriate negative controls .
The optimal working dilution for anti-SpCas9 IgY antibodies in Western blot applications is typically in the range of 1:1000 to 1:5000 of the P35% fraction. For immunofluorescence applications, dilutions between 1:100 and 1:500 are generally effective. These concentrations may require optimization based on the specific experimental system and the method of antibody production .
Preexisting adaptive immunity to Cas9 represents a significant challenge for therapeutic applications. Research has demonstrated that a large percentage of humans have preexisting humoral and cell-mediated immune responses to various Cas9 orthologs:
| Cas9 Ortholog | Antibody Prevalence | T Cell Response Prevalence |
|---|---|---|
| SaCas9 | 78% | 78% |
| SpCas9 | 58% | 67% |
Table 2: Prevalence of preexisting immunity to Cas9 orthologs in human populations
To address this challenge, researchers should:
Screen for preexisting immunity in research subjects prior to treatment
Consider using less immunogenic Cas9 variants or orthologs
Implement transient expression systems to minimize immune exposure
Explore immunomodulatory strategies to suppress anti-Cas9 responses
Consider ex vivo approaches when feasible to avoid direct in vivo delivery of Cas9 proteins
These considerations are particularly important for clinical applications but may also impact animal studies depending on the model system used .
Epitope prediction tools such as ElliPro can be employed to identify antigenic determinants in the SpCas9 protein and assess potential cross-reactivity with other Cas9 variants. The top five antigenic determinants in SpCas9 as determined by bioinformatic analysis are:
| Antigenic Peptide in SpCas9 | Residue Position | Length | Score |
|---|---|---|---|
| RIDLS | 1359-1363 | 5 | 0.813 |
| EEFYKFIKPILEKMDGTEELLVKLNREDLLR | 370-400 | 31 | 0.798 |
| IKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGA | 322-367 | 46 | 0.792 |
| SFEKNPIDFLEAKGKDLII | 1173-1196 | 19 | 0.776 |
| SVLVVSVKELLGIT | 1142-1167 | 14 | 0.757 |
Table 3: Predicted antigenic determinants in SpCas9 protein
Sequence alignment with other Cas9 orthologs (SaCas9, FnCas9, NmCas9, CjCas9) reveals low sequence identity (<20%), suggesting limited cross-reactivity. This bioinformatic approach helps researchers predict the specificity of their antibodies and potential applications across different CRISPR systems .
Studies with monoclonal antibody therapies have demonstrated that combinations of non-competing antibodies can protect against viral escape mutations. This principle can be applied when considering antibody-based approaches targeting Cas9 or for other therapeutic applications. Key strategies include:
Utilizing combinations of two or more non-competing antibodies targeting different epitopes
Testing antibody combinations against known escape variants
Implementing structural analysis to ensure non-overlapping binding of antibody combinations
Conducting in vitro escape studies to assess resistance development
Data from REGEN-COV studies demonstrated that while escape variants rapidly emerged against individual antibodies regardless of dosage or treatment setting, combination therapy with non-competing antibodies effectively prevented resistance development .
Anti-SpCas9 antibodies have potential applications in Prime and Base editing systems, which utilize catalytically impaired Cas9 variants (dCas9) fused to other enzymatic domains. These applications include:
Verification of fusion protein expression: Confirming successful expression of dCas9 fusion proteins in experimental systems
Localization studies: Determining subcellular localization of editing machinery
Chromatin immunoprecipitation (ChIP): Identifying genomic binding sites of dCas9-based editors
Protein complex analysis: Investigating interactions between editing machinery and endogenous cellular components
While epitope accessibility may differ in fusion proteins, the high conservation of key domains in dCas9 variants suggests that antibodies raised against SpCas9 would likely recognize these engineered variants .
Anti-Cas9 antibodies show promise for integration into point-of-care (POC) CRISPR-based diagnostics for pathogen detection. Key applications include:
Quality control: Detecting and neutralizing unbound Cas9 molecules to reduce off-target interactions
Secondary validation: Providing confirmation of target DNA detection by Cas9-guide RNA complexes
Immobilization: Serving as capture agents in lateral flow or microfluidic diagnostic formats
Signal amplification: Enhancing detection sensitivity when conjugated with reporter molecules
This approach holds particular promise for rapid diagnosis of neglected tropical diseases such as leishmaniasis, offering improved reliability and confidence in diagnostic results .
Researchers can employ anti-Cas9 antibodies to investigate off-target effects through:
ChIP-seq analysis: Mapping genome-wide binding of Cas9 to identify potential off-target sites
Clearance studies: Monitoring persistence of Cas9 proteins in cellular compartments after gene editing
Immunohistochemistry: Assessing tissue distribution of Cas9 after therapeutic delivery
Adaptive immune response assessment: Quantifying anti-Cas9 immune responses that may impact therapeutic efficacy
These approaches provide critical safety information for translational applications of CRISPR technology, particularly as clinical trials advance .
Several factors can impact detection sensitivity when using anti-SpCas9 antibodies:
Antibody quality: Purity and specificity of the antibody preparation
Protein conformation: Native versus denatured states affecting epitope accessibility
Expression levels: Low abundance of target protein in biological samples
Background interference: Non-specific binding in complex biological matrices
Detection method: Western blot versus ELISA versus immunofluorescence
To optimize sensitivity, researchers should:
Test multiple antibody dilutions and blocking conditions
Consider enrichment steps for low-abundance samples
Use enhanced chemiluminescence (ECL) or fluorescent secondary antibodies
Include appropriate positive and negative controls
Consider alternative detection platforms for challenging samples
Polyclonal antibody preparations inherently exhibit batch-to-batch variability. To address this challenge, researchers should:
Create standard operating procedures (SOPs) for antibody production and quality control
Maintain consistent immunization protocols across production batches
Implement standardized purification methods using defined parameters
Perform validation testing against reference samples for each new batch
Consider pooling antibodies from multiple immunized animals to reduce variability
Maintain reference standards from successful batches for comparative testing
Additionally, researchers may consider developing monoclonal alternatives for applications requiring absolute consistency across experiments .