SPBC428.12c Antibody

What is SPBC428.12c and why is it important in research?

SPBC428.12c is an RNA-binding protein found in Schizosaccharomyces pombe (fission yeast) containing an RNA Recognition Motif (RRM) domain. The protein plays a potential role in post-transcriptional regulation, though its exact function remains under investigation. Researching this protein is valuable for understanding fundamental RNA processing mechanisms in eukaryotic cells.

The protein contains an RRM domain spanning amino acids 8-77 with the sequence: VHVGNLAPSVTESLLYNAFIPFGEIISVALHRKEKAVDRSYAFVEFDEPEDAKEAMENMNYSILCDRCIR . This domain likely mediates its interaction with RNA molecules in cellular processes.

Expression analysis under nitrogen starvation conditions shows dynamic regulation:

-N+P: Nitrogen starved in the presence of P-factor; -N-P: Nitrogen starved in the absence of P-factor

How are antibodies against SPBC428.12c validated for research applications?

Validating SPBC428.12c antibodies involves multiple complementary approaches:

• Western blotting: The antibody should detect a band of the expected molecular weight (~27 kDa) in S. pombe lysates but not in knockout strains.

• Immunoprecipitation followed by mass spectrometry: This confirms the antibody's ability to specifically capture SPBC428.12c from complex cellular mixtures.

• Immunofluorescence: Localization patterns should be consistent with RNA-binding protein distribution and disappear in knockout cells.

Applying knockout validation methodology similar to the CRISPR/Cas9 approach used for human proteins is particularly valuable. This involves comparing antibody reactivity between wild-type and CRISPR-generated SPBC428.12c knockout S. pombe strains, with a positive control like tubulin to normalize signal intensity.

How can SPBC428.12c antibodies be used to study RNA-protein interactions?

SPBC428.12c antibodies enable several powerful approaches to study RNA-protein interactions:

RNA Immunoprecipitation (RIP): Use the following optimized protocol:

• Crosslink S. pombe cells with 1% formaldehyde for 10 minutes

• Lyse cells in buffer containing 50 mM HEPES pH 7.5, 140 mM NaCl, 1 mM EDTA, 1% Triton X-100, 0.1% sodium deoxycholate, and RNase inhibitors

• Immunoprecipitate with SPBC428.12c antibody (typically 5-10 μg per sample)

• Isolate and analyze bound RNAs by RT-PCR or RNA sequencing

CLIP (Cross-Linking Immunoprecipitation): For mapping precise RNA-binding sites:

• UV crosslink cells at 254 nm

• Perform limited RNase digestion

• Immunoprecipitate with SPBC428.12c antibody

• Isolate RNA fragments and perform high-throughput sequencing

These approaches allow identification of the RNA targets of SPBC428.12c, providing insights into post-transcriptional regulatory networks in S. pombe.

What controls should be included when using SPBC428.12c antibodies in immunoprecipitation experiments?

Robust controls are essential for reliable results with SPBC428.12c antibodies:

• Pre-immune serum control: Use pre-immune serum (available with some commercial SPBC428.12c antibodies ) to establish baseline non-specific interactions.

• Isotype control: Include an irrelevant antibody of the same isotype (IgG) to identify non-specific binding.

• Input control: Analyze 5-10% of the lysate used for immunoprecipitation to quantify enrichment.

• SPBC428.12c knockout/knockdown: Where available, use lysates from SPBC428.12c-deficient cells as negative control.

• Peptide competition: Pre-incubate antibody with excess recombinant SPBC428.12c (available commercially ) to confirm specificity.

• RNase treatment control: Include samples treated with RNase to distinguish RNA-dependent interactions.

For quantitative analysis, normalize IP efficiency using spike-in controls and apply appropriate statistical tests to determine significant enrichment.

How does antibody epitope selection affect SPBC428.12c research outcomes?

The epitope recognized by an SPBC428.12c antibody significantly impacts experimental outcomes and interpretations:

RRM domain-targeting antibodies: These may block RNA binding, allowing functional inhibition studies but potentially limiting detection of RNA-bound SPBC428.12c complexes. When using recombinant proteins as immunogens , evaluate whether the antibody recognizes the RRM domain (amino acids 8-77).

C-terminal-targeting antibodies: Generally better for detecting full-length protein without interfering with RNA binding, but may miss truncated isoforms.

Research has demonstrated that for RNA-binding proteins with RRM domains similar to SPBC428.12c, epitope location can affect detection of protein-protein interactions. For example, when performing co-immunoprecipitation experiments, consider whether the antibody epitope overlaps with protein interaction surfaces.

Polyclonal antibodies raised against full-length protein offer advantages for some applications due to recognition of multiple epitopes, while monoclonal antibodies provide greater consistency between experiments.

What methodological approaches can address cross-reactivity issues with SPBC428.12c antibodies?

Cross-reactivity can be a significant challenge, especially considering the homology between SPBC428.12c and related proteins:

Sequence homology analysis: SPBC428.12c shares approximately 74.3% sequence identity with orthologs in related species like Schizosaccharomyces cryophilus (SPOG_02286) and Schizosaccharomyces octosporus (SOCG_02693) . This homology should be considered when interpreting cross-reactivity patterns.

Affinity purification: Improve antibody specificity through:

• Pre-adsorption against lysates from other yeast species

• Affinity purification using immobilized recombinant SPBC428.12c

• Epitope-specific purification targeting unique regions

Validation in multiple systems:

• Western blot analysis in S. pombe vs. related species

• Comparative immunoprecipitation with mass spectrometry identification

• Immunodepletion experiments to identify cross-reactive proteins

When cross-reactivity cannot be eliminated, computational approaches similar to those used for deconvoluting antibody signals in complex samples can be applied to distinguish specific from non-specific signals.

How can SPBC428.12c antibodies be used to investigate protein localization during cellular stress responses?

SPBC428.12c expression patterns change during nitrogen starvation , suggesting stress-dependent functions. To investigate this:

Immunofluorescence protocol optimization:

• Fix cells with 4% paraformaldehyde for 15 minutes

• Permeabilize with 0.1% Triton X-100

• Block with 3% BSA in PBS

• Incubate with SPBC428.12c antibody (1:100-1:500 dilution)

• Apply fluorophore-conjugated secondary antibody

• Counterstain nucleus with DAPI

Time-course analysis during stress:
Monitor localization changes during:

• Nitrogen starvation

• Oxidative stress

• Heat shock

• Cell cycle arrest

Co-localization studies:
Combine SPBC428.12c antibodies with markers for:

• P-bodies (RNA processing bodies)

• Stress granules

• Nuclear speckles

• Nucleolus

Use quantitative image analysis to measure colocalization coefficients and correlate with stress intensity and duration.

What are the methodological approaches for studying SPBC428.12c post-translational modifications using specific antibodies?

Post-translational modifications (PTMs) often regulate RNA-binding protein function. To investigate SPBC428.12c PTMs:

Phosphorylation-specific antibody development:

• Identify potential phosphorylation sites using algorithms like NetPhos

• Generate phospho-specific antibodies against predicted sites

• Validate using lambda phosphatase treatment controls

PTM detection workflow:

• Immunoprecipitate SPBC428.12c from cells under various conditions

• Analyze by Western blot with phospho-specific antibodies

• Confirm by mass spectrometry using:

  • Enrichment of phosphopeptides with TiO₂

  • Parallel reaction monitoring for targeted analysis

  • Data-independent acquisition for discovery

Functional correlation:
Compare RNA-binding properties of modified vs. unmodified SPBC428.12c using:

• Differential RIP under conditions promoting modification

• In vitro binding assays with recombinant proteins mimicking modifications

• Microscopy to correlate localization with modification status

This approach has revealed regulatory PTMs in other RNA-binding proteins with RRM domains and could provide insights into SPBC428.12c regulation.

How can researchers design experiments to identify the RNA binding motifs recognized by SPBC428.12c?

Understanding the RNA sequences recognized by SPBC428.12c requires integrated approaches:

CLIP-seq with motif analysis:

• Perform CLIP-seq using SPBC428.12c antibodies

• Analyze enriched motifs using algorithms like MEME, HOMER, or RNAcompete

• Validate motifs by constructing a position weight matrix

In vitro binding studies:

• Express and purify recombinant SPBC428.12c

• Perform RNA Bind-n-Seq or similar high-throughput binding assays

• Compare binding affinities between wild-type and mutant RNAs

Structural approaches:

• Use NMR or X-ray crystallography to determine SPBC428.12c-RNA complex structures

• Apply molecular dynamics simulations to predict binding energetics

• Validate key interactions through mutagenesis

Comparative analysis:
Based on RRM domain similarity (RRM residing at positions 8-77 ), compare SPBC428.12c binding preferences with related RNA-binding proteins from the RRM family to identify conserved recognition principles.

How can researchers investigate the role of SPBC428.12c in stress granule formation during cellular stress?

RNA-binding proteins often participate in stress granule dynamics during cellular stress responses. To investigate SPBC428.12c's role:

Live cell imaging protocol:

• Generate S. pombe strains expressing fluorescently tagged SPBC428.12c

• Apply various stressors (oxidative stress, heat shock, glucose deprivation)

• Track protein localization using time-lapse microscopy

• Quantify stress granule formation kinetics

Stress granule proteome analysis:

• Isolate stress granules using differential centrifugation

• Immunoblot for SPBC428.12c

• Perform proximity labeling using APEX2 fused to SPBC428.12c

• Identify interaction partners by mass spectrometry

Functional assessment:

• Create SPBC428.12c deletion strains

• Quantify changes in stress granule formation

• Analyze RNA content of stress granules in wild-type vs. deletion strains

• Measure cell survival under stress conditions

Mechanistic insights:
Compare stress granule association patterns with the gene expression changes observed during nitrogen starvation to determine whether SPBC428.12c regulates specific transcripts under stress conditions.

How can researchers troubleshoot inconsistent Western blot results when using SPBC428.12c antibodies?

Inconsistent Western blot results with SPBC428.12c antibodies can stem from multiple factors:

Sample preparation optimization:

• Extract proteins using buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1% NP-40, 0.5% sodium deoxycholate, and protease inhibitors

• Include phosphatase inhibitors if investigating phosphorylated forms

• Denature samples at 70°C for 10 minutes rather than boiling to prevent aggregation

Antibody-specific parameters:

• Titrate antibody concentration (1:500 to 1:5000)

• Test different blocking agents (5% milk vs. 3% BSA)

• Optimize incubation conditions (overnight at 4°C vs. 2 hours at room temperature)

• Consider using anti-rabbit HRP secondary antibody at 1:10,000 dilution

Technical adjustments:

• For faint signals, use enhanced chemiluminescence substrates with longer exposure times

• If background is high, increase washing duration and detergent concentration

• For multiple bands, validate with recombinant protein control and knockout samples

• Consider using gradient gels for better resolution of close molecular weight proteins

Validation approaches:
Compare results using polyclonal vs. monoclonal antibodies targeting different epitopes to confirm band identity.

What strategies can improve co-immunoprecipitation efficiency when studying SPBC428.12c interaction partners?

Optimizing co-immunoprecipitation (co-IP) for SPBC428.12c requires careful consideration of experimental conditions:

Lysate preparation:

• Test multiple lysis buffers:

  • Low stringency: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.5% NP-40

  • Medium stringency: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1% Triton X-100

  • High stringency: RIPA buffer

• Include RNase inhibitors to preserve RNA-dependent interactions

• Use fresh lysates whenever possible

Immunoprecipitation conditions:

• Pre-clear lysates with Protein A/G beads

• Optimize antibody:lysate ratio (typically 2-10 μg antibody per mg protein)

• Test both direct antibody coupling to beads and indirect capture with Protein A/G

• Extend incubation time (4 hours to overnight) at 4°C with gentle rotation

Washing optimization:

• Perform sequential washes with increasing stringency

• Include control washes with and without RNase to distinguish RNA-dependent interactions

• Compare native vs. crosslinked samples to capture transient interactions

Detection methods:

• Use a combination of Western blotting and mass spectrometry

• Apply techniques like SAINT scoring to distinguish true interactions from background

• Validate key interactions through reciprocal co-IP or proximity labeling

For RNA-binding proteins like SPBC428.12c, consider that the best co-IP conditions may differ depending on whether you're targeting protein-protein or ribonucleoprotein complex interactions.

How might advanced antibody engineering techniques be applied to create better tools for SPBC428.12c research?

Emerging antibody engineering technologies offer opportunities to develop enhanced research tools for SPBC428.12c:

Nanobody development:
Single-domain antibodies (nanobodies) against SPBC428.12c could offer advantages similar to those demonstrated for other research antibodies :

• Smaller size enabling better penetration in fixed samples

• Higher stability in different buffer conditions

• Potential for intracellular expression as functional inhibitors

• Improved accessibility to epitopes in complex structures

Bispecific antibody applications:
Create bispecific antibodies targeting SPBC428.12c and:

• Common tags for standardized detection

• Suspected interaction partners for complex visualization

• Subcellular markers for improved localization studies

Antibody fragments for structural studies:
Engineer Fab or scFv fragments similar to those used in crystallography studies of antibody-antigen complexes to:

• Facilitate co-crystallization with SPBC428.12c

• Enable structure determination by cryo-EM

• Provide tools for epitope mapping

Recombinant antibody libraries:
Apply techniques similar to those used for high-throughput synthesis and specificity characterization of antibodies to develop panels of SPBC428.12c antibodies with diverse properties and applications.

How can computational approaches enhance antibody-based studies of SPBC428.12c function?

Computational methods can significantly augment antibody-based SPBC428.12c research:

Epitope prediction and antibody design:

• Use AlphaFold or RoseTTAFold to predict SPBC428.12c structure

• Apply epitope prediction algorithms to identify optimal antibody targets

• Design antibodies in silico before experimental validation

Data integration frameworks:

• Combine antibody-based data (immunoprecipitation, ChIP-seq, etc.) with:

  • Transcriptomics data

  • Protein interaction networks

  • Evolutionary conservation analysis

• Build predictive models of SPBC428.12c function based on integrated datasets

Machine learning for image analysis:

• Train algorithms to quantify SPBC428.12c subcellular localization in microscopy data

• Develop automated methods for measuring colocalization with interaction partners

• Apply computer vision to detect subtle phenotypes in SPBC428.12c-manipulated cells