YIF1A is a conserved eukaryotic protein encoded by the YIF1A gene (Entrez Gene ID: 10897; UniProt ID: O95070) located on human chromosome 11q13.2 . It belongs to the Yip1 domain family and regulates membrane transport between the ER and Golgi . The YIF1A antibody, such as the polyclonal PA5-45929 from Thermo Fisher Scientific, targets specific epitopes (e.g., peptide sequence: SDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGA) for immunoblotting, immunofluorescence, and co-immunoprecipitation studies .
Membrane Trafficking Studies: YIF1A antibodies validate its role in ER-to-Golgi transport and ERGIC localization .
Neurodegenerative Disease Research: YIF1A interacts with ALS8-associated protein VAPB, influencing dendritic trafficking and morphology in neurons .
Viral Pathogenesis: Identifies interactions with SARS-CoV-2 M protein, suggesting a role in viral assembly .
Golgi Structure Maintenance: Knockdown experiments link YIF1A to Golgi integrity .
Limitations: Not for diagnostic use; requires validation in non-standard model organisms .
Knockdown Effects: Reduced YIF1A expression alters ERGIC morphology and impairs dendritic growth .
Research priorities include elucidating YIF1A's role in viral pathogenesis and developing antibodies targeting specific post-translational modifications (e.g., glycosylation sites at Lys104/161/211) . Additionally, structural studies using cryo-EM could resolve its interaction mechanisms with VAPB and SARS-CoV-2 proteins.
YIF1A (Yip1 interacting factor homolog A) is a membrane trafficking protein that belongs to the Yip1 domain family. It is known by several alternative names including 54TM, FinGER7, YIF1, and YIF1P. The protein is encoded by the YIF1A gene located on chromosome 11 at position 11q13.2 in humans . YIF1A is important to study because:
It plays a critical role in intracellular membrane trafficking between the ER and Golgi apparatus
It interacts with VAPB, a protein associated with amyotrophic lateral sclerosis (ALS8)
It is involved in dendritic morphology and membrane trafficking into dendrites
YIF1A is widely expressed across human tissues, with highest expression in the duodenum and liver, and moderate levels in tissues including the colon, ovary, pancreas, spleen, and esophagus .
Several types of YIF1A antibodies are available for research purposes, including:
Polyclonal antibodies: These recognize multiple epitopes on the YIF1A protein and are useful for general detection. Examples include rabbit polyclonal antibodies (such as HPA076194) .
Monoclonal antibodies: These recognize a single epitope and provide consistent results across experiments .
Species-specific antibodies: Available with reactivity to human, mouse, rat, cow, dog, guinea pig, horse, and pig YIF1A proteins .
These antibodies are validated for various applications:
| Antibody Type | Reactivity | Applications | Catalog Examples | Quantity |
|---|---|---|---|---|
| Polyclonal | Cow, Guinea Pig, Horse, Human, Pig, Rat | Western Blot (WB) | ABIN6750082 | 100 μL |
| Polyclonal | Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat | Western Blot (WB) | ABIN2790602 | 100 μL |
| Polyclonal | Human | Western Blot (WB) | ABIN5517656 | 100 μL |
| Protein | Human | Multiple applications | ABIN1325515 | 10 μg |
Source: Adapted from antibodies-online.com catalog data
Proper validation of YIF1A antibodies is crucial to ensure experimental reliability. The validation process should include:
Standard validation: Compare antibody results with existing experimental data from reliable sources such as UniProtKB/Swiss-Prot database .
Enhanced validation: This involves multiple approaches:
siRNA knockdown: Evaluate the decrease in antibody staining intensity when the target protein is downregulated . This method has been successfully used to validate YIF1A antibodies in several studies .
Tagged GFP cell lines: Evaluate signal overlap between antibody staining and a GFP-tagged version of YIF1A .
Independent antibodies: Compare staining patterns from two or more independent antibodies directed towards different epitopes on YIF1A .
Application-specific validation:
A comprehensive validation approach should include positive and negative controls and demonstrate reproducibility across different experimental conditions.
YIF1A exhibits a distinctive subcellular localization pattern that can be detected using immunofluorescence techniques:
Normal distribution pattern: YIF1A is present in a reticular network throughout the neuron and localizes to discrete puncta in the cell body . This reticular staining partially co-localizes with:
Detection methods:
Important considerations:
Fixation is critical: acetone or paraformaldehyde are recommended as they cause less antigen denaturation while maintaining cell morphology
Permeabilization may be necessary to expose epitopes located in membrane structures
Controls should include samples incubated only with secondary antibody to determine non-specific binding
Researchers should note that YIF1A distribution can change under different experimental conditions - for example, VAPB knockdown leads to accumulation of YIF1A in the perinuclear region and increased co-localization with Golgi and ERGIC markers .
YIF1A forms specific interactions with VAPB (vesicle-associated membrane protein-associated protein B), which can be studied using various antibody-based techniques:
Interaction domains:
Methods to study interactions:
Biotin pull-down experiments: Using extracts of cells overexpressing GFP-YIF1A and bio-HA-VAPB
Co-immunoprecipitation: To detect binding between YIF1A and VAPB variants
Immunofluorescence co-localization: In COS-7 cells, HA-YIF1A co-localizes with both endogenous VAPB and co-transfected myc-VAPB in the ER
Functional significance:
VAPB strongly affects the distribution of YIF1A and retains it in the ER
VAPB overexpression increases the immobile fraction of YIF1A molecules in the ER, as demonstrated by FRAP (fluorescence recovery after photobleaching) experiments
VAPA/B knockdown leads to translocation of YIF1A to post-ER structures (Golgi and ERGIC)
This interaction appears to be functionally distinct from the yeast homolog interaction, as mutations that disrupt Yip1p-Yif1p binding in yeast (such as E89G) do not affect YIF1A function in ER structural maintenance .
When performing immunofluorescence (IF) or immunohistochemistry (IHC) with YIF1A antibodies, appropriate controls are essential for result validation:
Negative controls:
Positive controls:
Expression validation controls:
Technical considerations:
For IHC specifically, inhibition of endogenous peroxidases may be necessary, especially in tissues with high macrophage or granulocyte content, to prevent interference with the reaction .
Studying YIF1A mutations requires sophisticated antibody-based approaches focused on key functional domains:
Critical domains for antibody targeting:
Mutation analysis approaches:
Site-directed mutagenesis coupled with immunoprecipitation: To study how specific mutations affect protein-protein interactions
Structure-function analysis: Creating truncated YIF1A constructs containing specific domains and analyzing their localization and binding partners using domain-specific antibodies
GxxxG motif mutations: These motifs in the first and third transmembrane domains can be targeted to study transmembrane helix interactions, though they appear not to interfere with VAPB binding
Functionally significant mutations:
E95K mutation: Corresponds to the lethal yip1-6 allele in yeast and disrupts YIF1A function in ER structural maintenance
E89G mutation: Corresponds to the lethal yip1-41 allele in yeast that abolishes binding of Yip1p to Yif1p and Ypt1p/Ypt31p, but surprisingly does not affect ER structural maintenance by YIF1A
K146E and V152L mutations: These affect YIF1A function in maintaining ER structure
Experimental approaches:
When designing antibodies against mutant forms of YIF1A, researchers should consider that mutations may alter epitope accessibility or antibody binding affinity.
Studying YIF1A-dependent membrane trafficking in neurons presents unique challenges that can be addressed with specialized antibody-based approaches:
Challenges in neuronal systems:
Complex morphology with compartmentalized membrane trafficking pathways
Need to distinguish between somatic, dendritic, and axonal compartments
Dynamic nature of membrane trafficking events
Requirement for primary neuronal cultures with proper differentiation
Advanced antibody-based solutions:
Live-cell imaging: Use of fluorescently tagged antibody fragments to track YIF1A dynamics in real-time
Super-resolution microscopy: STORM or PALM imaging with highly specific antibodies to visualize YIF1A-containing membrane compartments beyond the diffraction limit
Proximity labeling: BioID or APEX2 approaches coupled with YIF1A antibodies to identify proteins in close proximity in specific neuronal compartments
Multiplexed immunofluorescence: Simultaneous detection of YIF1A with multiple organelle markers to track its distribution in neurons
Neuronal-specific considerations:
Dendritic targeting: YIF1A is required for intracellular membrane trafficking into dendrites
VAPB interaction: VAPB strongly affects YIF1A distribution and is required for normal dendritic morphology
Compartmentalized analysis: When investigating YIF1A in neurons, separate analysis of soma versus dendritic/axonal compartments is essential
Methodological approach:
Establish primary neuronal cultures (DIV16 neurons have been successfully used)
Use shRNA-mediated knockdown of YIF1A with rescue constructs to study function
Apply confocal microscopy with antibodies against YIF1A, ER markers (PDI), ERGIC markers (ERGIC53/p58), and Golgi markers (GM130)
Quantify co-localization of YIF1A with different organelle markers under various conditions (control vs. VAPB knockdown)
Research indicates that VAPB knockdown neurons display a strong accumulation of YIF1A in the perinuclear region and increased co-localization with Golgi and ERGIC markers, suggesting a role for VAPB in regulating YIF1A recycling between these compartments .
Quantitative analysis of YIF1A immunofluorescence data requires sophisticated approaches to accurately measure protein distribution, co-localization, and dynamics:
Quantification of subcellular distribution:
Intensity profiling: Measure fluorescence intensity along defined linear regions crossing different cellular compartments
Compartment segmentation: Define regions of interest (ROIs) corresponding to ER, ERGIC, and Golgi compartments and quantify YIF1A fluorescence intensity in each
Distance analysis: Measure the distance of YIF1A puncta from defined cellular landmarks (e.g., nucleus, cell periphery)
Co-localization analysis methods:
Pearson's correlation coefficient: Measure the pixel-by-pixel correlation between YIF1A and organelle markers (e.g., PDI for ER, ERGIC53/p58 for ERGIC, GM130 for Golgi)
Manders' overlap coefficient: Determine the fraction of YIF1A that overlaps with specific organelle markers
Object-based co-localization: Count the number of YIF1A-positive puncta that overlap with organelle markers
Example of co-localization quantification:
| Condition | YIF1A/GM130 Co-localization | YIF1A/ERGIC53 Co-localization | Sample Size |
|---|---|---|---|
| Control | Low (baseline) | Partial | n > 100 |
| VAPB KD | Significantly increased | Significantly increased | n > 100 |
Dynamic analysis techniques:
FRAP (Fluorescence Recovery After Photobleaching): Measure YIF1A mobility by bleaching a defined area and monitoring fluorescence recovery
Key parameters: Recovery half-time (t½), mobile fraction, immobile fraction
Example finding: VAPB overexpression decreased GFP-YIF1A maximum recovery from ~90% to ~70%, indicating an increase in the immobile fraction
Best practices for data interpretation:
Multiple independent experiments: Perform at least three independent experiments (>100 cells per condition)
Blinded analysis: Have observers blinded to experimental conditions perform quantification
Appropriate statistical analysis: Use tests like Student's t-test for pairwise comparisons or ANOVA for multiple conditions
Controls for photobleaching: Include non-bleached regions to control for acquisition bleaching during FRAP experiments
Standardized imaging parameters: Use consistent exposure times, detector settings, and post-processing steps across all samples
Biological context interpretation: Interpret changes in YIF1A distribution in relation to its known function in membrane trafficking between ER and Golgi
When publishing YIF1A immunofluorescence data, it is important to report all image acquisition parameters, quantification methods, and statistical analyses to ensure reproducibility.
Analyzing YIF1A across different model systems requires careful consideration of species-specific differences and system-appropriate antibody selection:
Species-specific considerations:
Human vs. rodent systems: While YIF1A is conserved, there are sequence differences that may affect antibody recognition
Yeast Yif1p vs. mammalian YIF1A: Despite homology, functional differences exist - mutations that disrupt Yip1p-Yif1p binding in yeast (E89G) do not affect YIF1A function in mammals
Cross-reactivity range: Some antibodies show reactivity across multiple species (human, mouse, rat, cow, dog, guinea pig, horse, pig)
Cell/tissue-specific considerations:
Neurons: YIF1A forms a reticular network with discrete puncta in the cell body and dendrites
Non-neuronal cells: YIF1A shows stronger Golgi/ERGIC localization in many cell types
Tissue expression patterns: Highest in duodenum and liver, with moderate levels in colon, ovary, pancreas, spleen, and esophagus
Model system-specific antibody selection:
| Model System | Recommended Antibody Type | Critical Validation | Application Notes |
|---|---|---|---|
| Human cell lines | Human-specific mAbs or pAbs | Validate in human tissue extracts | Effective for most applications |
| Mouse neurons | Cross-reactive or mouse-specific Abs | Validate in mouse brain lysates | Critical for dendritic studies |
| Yeast (S. cerevisiae) | Yif1p-specific antibodies | Validate in yeast lysates | Focus on structural conservation |
| Tissue sections | Well-characterized IHC-validated Abs | Test on multiple tissue types | Requires specific fixation protocols |
System-specific validation approaches:
Cell lines: siRNA knockdown followed by Western blot or immunofluorescence
Primary neurons: shRNA knockdown with phenotype rescue by resistant constructs
Yeast: Use of knockout strains with complementation by mammalian YIF1A
Tissues: Compare with established expression patterns and use multiple antibodies against different epitopes
Technical adaptations:
Fixation protocols: Optimize for each system (4% PFA for neurons, acetone for cell lines)
Permeabilization: May need adjustment (0.1% Triton X-100 for cells, 0.3% for tissue sections)
Antigen retrieval: Often necessary for formalin-fixed tissues but not for cultured cells
Blocking conditions: Serum from the same species as secondary antibody is recommended
When publishing results from multiple model systems, researchers should explicitly state which antibodies were used for each system and how they were validated in that specific context.
Western blot analysis with YIF1A antibodies can present several challenges that require specific troubleshooting approaches:
Common issues and solutions:
| Issue | Possible Causes | Solutions |
|---|---|---|
| No signal | Degraded protein, ineffective antibody | Use fresh lysates, include protease inhibitors, verify antibody reactivity |
| Multiple bands | Cross-reactivity, protein degradation, post-translational modifications | Use more specific antibody, optimize protein extraction, use appropriate negative controls |
| High background | Insufficient blocking, excessive antibody concentration | Increase blocking time, titrate antibody, optimize washing steps |
| Weak signal | Low YIF1A expression, inefficient transfer | Increase protein loading, optimize transfer conditions, use signal enhancement systems |
| Unexpected molecular weight | Post-translational modifications, splice variants | Compare with positive controls, investigate potential modifications |
Optimization strategies:
Sample preparation: YIF1A is a membrane protein with four transmembrane domains , so effective membrane protein extraction buffers containing detergents (e.g., 1% Triton X-100 or RIPA buffer) are essential
Protein denaturation: Heat samples at 70°C instead of 95°C to prevent membrane protein aggregation
Transfer conditions: Use wet transfer for more efficient transfer of membrane proteins
Antibody selection: For Western blot applications, multiple YIF1A antibodies are available with WB validation
YIF1A-specific considerations:
Expected molecular weight: ~32 kDa for full-length human YIF1A
Detection of truncated constructs: When analyzing domain-specific constructs (e.g., YIF1A 131-198), adjust expected molecular weight calculations accordingly
Co-detection with interacting partners: When studying interactions with VAPB, consider using dual-color detection systems
Validation approaches:
Optimizing immunoprecipitation (IP) experiments for YIF1A requires careful consideration of its membrane-embedded nature and interaction properties:
Lysis and solubilization considerations:
Gentle detergents: Use mild detergents like digitonin (0.5-1%), CHAPS (0.5-1%), or NP-40 (0.5-1%) to solubilize membrane proteins while preserving interactions
Buffer composition: Include protease inhibitors, phosphatase inhibitors, and appropriate salt concentration (typically 150mM NaCl)
Temperature conditions: Perform lysis and IP steps at 4°C to preserve interactions
IP strategies for YIF1A interactions:
Direct IP: Using YIF1A antibodies directly coupled to beads
Reverse IP: Immunoprecipitating known interaction partners (e.g., VAPB) and detecting YIF1A in the precipitate
Tagged constructs: Using epitope-tagged YIF1A (HA, FLAG, GFP) for more specific pulldown
Biotin-based approaches: Using biotinylated constructs with streptavidin beads for cleaner pulldowns
Approaches shown to be effective in YIF1A studies:
Controls and validation:
Input controls: Check expression levels of both target proteins before IP
Negative controls: Use IgG of the same species as the IP antibody
Specificity controls: Perform IP after knockdown of YIF1A to confirm specificity
Reciprocal IP: Confirm interactions by performing IP in both directions
Competition assays: Use excess purified peptide to demonstrate specificity
Advanced techniques for challenging interactions:
Crosslinking: Use membrane-permeable crosslinkers like DSP or formaldehyde to stabilize transient interactions
Proximity labeling: BioID or APEX2 approaches to identify proteins in close proximity to YIF1A
Sequential IP: For complex formation analysis, perform tandem purification with different tags
Research has demonstrated that the transmembrane domains of both YIF1A and VAPB are required for their interaction, with the first two transmembrane domains of YIF1A (residues 131-198) showing strongest interaction with VAPB . This knowledge can guide experimental design when studying YIF1A protein interactions.
Successful immunofluorescence studies of YIF1A in neuronal systems require attention to several critical parameters:
Sample preparation:
Fixation: 4% paraformaldehyde (10-15 minutes at room temperature) preserves YIF1A localization while maintaining neuronal morphology
Permeabilization: Mild detergents (0.1-0.3% Triton X-100 or 0.1% saponin) are essential to access the cytoplasmic portions of YIF1A while preserving membrane integrity
Blocking: Use 5-10% normal serum from the same species as the secondary antibody to minimize background
Antibody selection and validation:
Epitope accessibility: Choose antibodies targeting the N-terminal cytosolic domain for better accessibility
Specificity verification: Validate using YIF1A knockdown neurons to confirm specific staining
Secondary antibodies: Select highly cross-adsorbed secondary antibodies to minimize cross-reactivity in multi-labeling experiments
Neuronal-specific considerations:
Developmental stage: Mature neurons (DIV16) show robust YIF1A expression and distribution patterns
Compartment analysis: Separately analyze cell body versus dendritic regions
Co-labeling strategy: Include markers for ER (PDI), ERGIC (ERGIC53/p58), and Golgi (GM130) to fully characterize YIF1A distribution
Imaging parameters:
Confocal microscopy: Essential for resolving YIF1A distribution in the complex neuronal architecture
Z-stack acquisition: Necessary for complete visualization of the three-dimensional distribution of YIF1A
Exposure settings: Optimize to prevent saturation while capturing the full dynamic range
Resolution: Use appropriate numerical aperture objectives (NA ≥ 1.3) for high-resolution imaging
Experimental examples:
In DIV16 neurons, YIF1A presents in a reticular network throughout the neuron with discrete puncta in the cell body
The reticular YIF1A staining partially co-localizes with endogenous VAPB and ER markers
YIF1A-positive puncta in the cell body coincide with the ERGIC
VAPA/B knockdown neurons display a consistent change in YIF1A localization, with strong accumulation in the perinuclear region and increased co-localization with Golgi and ERGIC markers
Quantification approaches:
Co-localization analysis: Quantify overlap between YIF1A and organelle markers using Pearson's or Manders' coefficients
Distribution patterns: Measure the relative intensity of YIF1A in different cellular compartments
Morphological analysis: Assess effects of YIF1A manipulation on dendritic morphology
These parameters have been successfully applied in studies demonstrating that VAPB knockdown causes redistribution of YIF1A from the ER to post-ER structures in neurons, suggesting a role for VAPB in regulating YIF1A recycling between these compartments .
Research on YIF1A using antibody-based approaches has significantly advanced our understanding of membrane trafficking and neuronal function in several key ways:
ER-Golgi membrane trafficking regulation:
YIF1A functions in the recycling pathway between ER and Golgi compartments
VAPB binding regulates YIF1A distribution, retaining it in the ER and inhibiting its recycling into ERGIC and Golgi
YIF1A mobility and dynamics are directly influenced by VAPB levels, with VAPB overexpression increasing the immobile fraction of YIF1A molecules in the ER
Neuronal membrane trafficking mechanisms:
Implications for neurodegenerative diseases:
ER structural maintenance:
YIF1A appears to play a role in maintaining ER structure that is separate from its interaction with Yif1A or Rab GTPases
Specific mutations in YIF1A (e.g., E95K) disrupt its function in ER structural maintenance
The ability of YIF1A to bind its established partners may be uncoupled from its ability to control ER morphology
Evolutionary conservation and divergence:
These findings highlight YIF1A as a crucial component of cellular membrane trafficking systems, particularly in neurons, with potential implications for understanding both normal cellular function and disease mechanisms. Antibody-based approaches have been instrumental in revealing these functions by enabling detailed analysis of YIF1A localization, interactions, and dynamics in various cellular contexts.
YIF1A antibodies are finding applications beyond basic characterization of the protein, extending into emerging research areas:
Neurodegenerative disease research:
Developmental neurobiology:
Cellular stress responses:
Monitoring YIF1A dynamics during ER stress conditions
Investigating potential roles in unfolded protein response pathways
Examining YIF1A in autophagy and secretory pathway stress
Advanced imaging applications:
Super-resolution microscopy of YIF1A-containing membrane domains
Live-cell imaging using YIF1A antibody fragments or nanobodies
Correlative light-electron microscopy to define ultrastructural localization
Multi-omics integration:
Using YIF1A antibodies for ChIP-seq to identify potential transcriptional regulators
Combining with proteomics approaches to define the complete YIF1A interactome
Integrating with lipidomics to understand lipid-protein interactions in membrane trafficking
Therapeutic target validation:
Screening for compounds that modulate YIF1A-VAPB interactions
Developing targeted approaches to normalize trafficking defects
Creating tools to monitor therapeutic efficacy in disease models
As antibody technologies continue to advance, we can expect further refinement of these approaches and development of new applications for studying YIF1A in diverse research contexts.