yif1a Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to YIF1A and Its Antibody

YIF1A is a conserved eukaryotic protein encoded by the YIF1A gene (Entrez Gene ID: 10897; UniProt ID: O95070) located on human chromosome 11q13.2 . It belongs to the Yip1 domain family and regulates membrane transport between the ER and Golgi . The YIF1A antibody, such as the polyclonal PA5-45929 from Thermo Fisher Scientific, targets specific epitopes (e.g., peptide sequence: SDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGA) for immunoblotting, immunofluorescence, and co-immunoprecipitation studies .

Key Applications of YIF1A Antibody

  • Membrane Trafficking Studies: YIF1A antibodies validate its role in ER-to-Golgi transport and ERGIC localization .

  • Neurodegenerative Disease Research: YIF1A interacts with ALS8-associated protein VAPB, influencing dendritic trafficking and morphology in neurons .

  • Viral Pathogenesis: Identifies interactions with SARS-CoV-2 M protein, suggesting a role in viral assembly .

  • Golgi Structure Maintenance: Knockdown experiments link YIF1A to Golgi integrity .

Protein Characteristics

PropertyDetail
Molecular Weight~32.0 kDa (predicted: 32.4 kDa)
Isoelectric Point8.98
Domainspfam03878 (AA 57–287); 5 transmembrane helices
Post-Translational ModificationsN-terminal acetylation, phosphorylation, O-ß-GlcNAc glycosylation

Subcellular Localization

  • Primary: ER, ERGIC, and cis-Golgi .

  • Interactions: Binds VAPB, YIPF5, SEC23IP, and GPR37 .

Table 1: Key Studies on YIF1A Antibody Applications

Study FocusMethodologyKey FindingsSource
VAPB-YIF1A InteractionCo-immunoprecipitation, siRNAYIF1A-VAPB complex regulates dendritic membrane delivery; ALS8 mutant VAPB-P56S disrupts YIF1A localization .
ERGIC/Golgi RecyclingImmunofluorescence, subcellular fractionationYIF1A cycles between ER and Golgi; knockdown disrupts Golgi structure .
SARS-CoV-2 InteractionFluorescence microscopyYIF1A binds SARS-CoV-2 M protein, potentially aiding viral replication .
ER Stress ResponseCo-immunoprecipitationYIF1A induces ERN1/IRE1 during unfolded protein response .

Critical Considerations

  • Limitations: Not for diagnostic use; requires validation in non-standard model organisms .

  • Knockdown Effects: Reduced YIF1A expression alters ERGIC morphology and impairs dendritic growth .

Future Directions

Research priorities include elucidating YIF1A's role in viral pathogenesis and developing antibodies targeting specific post-translational modifications (e.g., glycosylation sites at Lys104/161/211) . Additionally, structural studies using cryo-EM could resolve its interaction mechanisms with VAPB and SARS-CoV-2 proteins.

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
yif1a; zgc:73136; Protein YIF1A; YIP1-interacting factor homolog A
Target Names
Uniprot No.

Target Background

Function
Yif1a antibody may play a role in the transport of proteins between the endoplasmic reticulum and the Golgi apparatus.
Database Links

KEGG: dre:334982

STRING: 7955.ENSDARP00000018303

UniGene: Dr.412

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is YIF1A and why is it important to study?

YIF1A (Yip1 interacting factor homolog A) is a membrane trafficking protein that belongs to the Yip1 domain family. It is known by several alternative names including 54TM, FinGER7, YIF1, and YIF1P. The protein is encoded by the YIF1A gene located on chromosome 11 at position 11q13.2 in humans . YIF1A is important to study because:

  • It plays a critical role in intracellular membrane trafficking between the ER and Golgi apparatus

  • It interacts with VAPB, a protein associated with amyotrophic lateral sclerosis (ALS8)

  • It is involved in dendritic morphology and membrane trafficking into dendrites

  • It has been implicated in the regulation of ER structure

YIF1A is widely expressed across human tissues, with highest expression in the duodenum and liver, and moderate levels in tissues including the colon, ovary, pancreas, spleen, and esophagus .

What types of YIF1A antibodies are available for research applications?

Several types of YIF1A antibodies are available for research purposes, including:

  • Polyclonal antibodies: These recognize multiple epitopes on the YIF1A protein and are useful for general detection. Examples include rabbit polyclonal antibodies (such as HPA076194) .

  • Monoclonal antibodies: These recognize a single epitope and provide consistent results across experiments .

  • Species-specific antibodies: Available with reactivity to human, mouse, rat, cow, dog, guinea pig, horse, and pig YIF1A proteins .

These antibodies are validated for various applications:

Antibody TypeReactivityApplicationsCatalog ExamplesQuantity
PolyclonalCow, Guinea Pig, Horse, Human, Pig, RatWestern Blot (WB)ABIN6750082100 μL
PolyclonalCow, Dog, Guinea Pig, Horse, Human, Mouse, RatWestern Blot (WB)ABIN2790602100 μL
PolyclonalHumanWestern Blot (WB)ABIN5517656100 μL
ProteinHumanMultiple applicationsABIN132551510 μg

Source: Adapted from antibodies-online.com catalog data

How should YIF1A antibodies be validated before use in experiments?

Proper validation of YIF1A antibodies is crucial to ensure experimental reliability. The validation process should include:

  • Standard validation: Compare antibody results with existing experimental data from reliable sources such as UniProtKB/Swiss-Prot database .

  • Enhanced validation: This involves multiple approaches:

    • siRNA knockdown: Evaluate the decrease in antibody staining intensity when the target protein is downregulated . This method has been successfully used to validate YIF1A antibodies in several studies .

    • Tagged GFP cell lines: Evaluate signal overlap between antibody staining and a GFP-tagged version of YIF1A .

    • Independent antibodies: Compare staining patterns from two or more independent antibodies directed towards different epitopes on YIF1A .

  • Application-specific validation:

    • For Western Blot: Verify correct protein molecular weight (~32 kDa for YIF1A)

    • For immunocytochemistry: Compare with published subcellular localization patterns (ER, ERGIC, and Golgi)

    • For immunohistochemistry: Assess staining patterns across multiple tissue types

A comprehensive validation approach should include positive and negative controls and demonstrate reproducibility across different experimental conditions.

What is the subcellular localization pattern of YIF1A and how can it be detected using antibodies?

YIF1A exhibits a distinctive subcellular localization pattern that can be detected using immunofluorescence techniques:

  • Normal distribution pattern: YIF1A is present in a reticular network throughout the neuron and localizes to discrete puncta in the cell body . This reticular staining partially co-localizes with:

    • Endogenous VAPB and ER marker protein disulphide isomerase (PDI)

    • ERGIC marker ERGIC53/p58 (shows partial co-localization in the cell body)

  • Detection methods:

    • Immunofluorescence: Using antibodies against YIF1A followed by fluorescently labeled secondary antibodies

    • Co-localization studies: Double-labeling with markers for ER (PDI), ERGIC (ERGIC53/p58), or Golgi (GM130)

  • Important considerations:

    • Fixation is critical: acetone or paraformaldehyde are recommended as they cause less antigen denaturation while maintaining cell morphology

    • Permeabilization may be necessary to expose epitopes located in membrane structures

    • Controls should include samples incubated only with secondary antibody to determine non-specific binding

Researchers should note that YIF1A distribution can change under different experimental conditions - for example, VAPB knockdown leads to accumulation of YIF1A in the perinuclear region and increased co-localization with Golgi and ERGIC markers .

How does YIF1A interact with VAPB, and how can these interactions be studied using antibodies?

YIF1A forms specific interactions with VAPB (vesicle-associated membrane protein-associated protein B), which can be studied using various antibody-based techniques:

  • Interaction domains:

    • The transmembrane domains of both YIF1A and VAPB are required for their interaction

    • The first two transmembrane domains of YIF1A (residues 131-198) show strongest interaction with VAPB

    • The single transmembrane domain of VAPB is important for binding YIF1A

  • Methods to study interactions:

    • Biotin pull-down experiments: Using extracts of cells overexpressing GFP-YIF1A and bio-HA-VAPB

    • Co-immunoprecipitation: To detect binding between YIF1A and VAPB variants

    • Immunofluorescence co-localization: In COS-7 cells, HA-YIF1A co-localizes with both endogenous VAPB and co-transfected myc-VAPB in the ER

  • Functional significance:

    • VAPB strongly affects the distribution of YIF1A and retains it in the ER

    • VAPB overexpression increases the immobile fraction of YIF1A molecules in the ER, as demonstrated by FRAP (fluorescence recovery after photobleaching) experiments

    • VAPA/B knockdown leads to translocation of YIF1A to post-ER structures (Golgi and ERGIC)

This interaction appears to be functionally distinct from the yeast homolog interaction, as mutations that disrupt Yip1p-Yif1p binding in yeast (such as E89G) do not affect YIF1A function in ER structural maintenance .

What controls should be included when performing immunofluorescence or immunohistochemistry with YIF1A antibodies?

When performing immunofluorescence (IF) or immunohistochemistry (IHC) with YIF1A antibodies, appropriate controls are essential for result validation:

  • Negative controls:

    • Secondary antibody only: Include samples incubated only with the secondary antibody to determine non-specific binding sites

    • Isotype controls: Use isotype-specific Ig as primary antibody

    • Pre-absorption controls: Pre-incubate antibody with excess antigen to demonstrate specificity

  • Positive controls:

    • Known expressing tissues: Include samples from tissues known to express YIF1A highly (duodenum, liver)

    • Overexpression samples: Cells transfected with YIF1A expression vectors

    • Reference patterns: Compare results with established subcellular distribution patterns (ER, ERGIC, Golgi)

  • Expression validation controls:

    • siRNA knockdown: Include samples where YIF1A has been depleted by siRNA to confirm antibody specificity

    • Cells with variable expression: Include cells that either do not express or have high expression of YIF1A

  • Technical considerations:

    • Antibody titration: Test a range of dilutions to minimize non-specific binding

    • Fixation optimization: Compare different fixatives as they may affect antigen preservation

    • Permeabilization: Optimize permeabilization protocols to ensure access to membrane-embedded epitopes

For IHC specifically, inhibition of endogenous peroxidases may be necessary, especially in tissues with high macrophage or granulocyte content, to prevent interference with the reaction .

How can mutations in YIF1A be studied using antibody-based techniques, and what are the key domains to focus on?

Studying YIF1A mutations requires sophisticated antibody-based approaches focused on key functional domains:

  • Critical domains for antibody targeting:

    • N-terminal cytosolic domain (residues 1-130): Faces the cytosol and contains highly conserved residues between positions 89-113

    • First two transmembrane domains (residues 131-198): Most critical for VAPB interaction

    • C-terminal region (199-293): Contains additional transmembrane domains

  • Mutation analysis approaches:

    • Site-directed mutagenesis coupled with immunoprecipitation: To study how specific mutations affect protein-protein interactions

    • Structure-function analysis: Creating truncated YIF1A constructs containing specific domains and analyzing their localization and binding partners using domain-specific antibodies

    • GxxxG motif mutations: These motifs in the first and third transmembrane domains can be targeted to study transmembrane helix interactions, though they appear not to interfere with VAPB binding

  • Functionally significant mutations:

    • E95K mutation: Corresponds to the lethal yip1-6 allele in yeast and disrupts YIF1A function in ER structural maintenance

    • E89G mutation: Corresponds to the lethal yip1-41 allele in yeast that abolishes binding of Yip1p to Yif1p and Ypt1p/Ypt31p, but surprisingly does not affect ER structural maintenance by YIF1A

    • K146E and V152L mutations: These affect YIF1A function in maintaining ER structure

  • Experimental approaches:

    • Rescue assays: Testing if mutant YIF1A constructs can rescue phenotypes caused by YIF1A knockdown

    • Immunofluorescence localization: Determining if mutations alter the subcellular distribution of YIF1A

    • FRAP analysis: Measuring how mutations affect the mobility and dynamics of YIF1A in membranes

When designing antibodies against mutant forms of YIF1A, researchers should consider that mutations may alter epitope accessibility or antibody binding affinity.

What are the methodological challenges in studying YIF1A-dependent membrane trafficking in neurons and how can antibodies help overcome them?

Studying YIF1A-dependent membrane trafficking in neurons presents unique challenges that can be addressed with specialized antibody-based approaches:

  • Challenges in neuronal systems:

    • Complex morphology with compartmentalized membrane trafficking pathways

    • Need to distinguish between somatic, dendritic, and axonal compartments

    • Dynamic nature of membrane trafficking events

    • Requirement for primary neuronal cultures with proper differentiation

  • Advanced antibody-based solutions:

    • Live-cell imaging: Use of fluorescently tagged antibody fragments to track YIF1A dynamics in real-time

    • Super-resolution microscopy: STORM or PALM imaging with highly specific antibodies to visualize YIF1A-containing membrane compartments beyond the diffraction limit

    • Proximity labeling: BioID or APEX2 approaches coupled with YIF1A antibodies to identify proteins in close proximity in specific neuronal compartments

    • Multiplexed immunofluorescence: Simultaneous detection of YIF1A with multiple organelle markers to track its distribution in neurons

  • Neuronal-specific considerations:

    • Dendritic targeting: YIF1A is required for intracellular membrane trafficking into dendrites

    • VAPB interaction: VAPB strongly affects YIF1A distribution and is required for normal dendritic morphology

    • Compartmentalized analysis: When investigating YIF1A in neurons, separate analysis of soma versus dendritic/axonal compartments is essential

  • Methodological approach:

    • Establish primary neuronal cultures (DIV16 neurons have been successfully used)

    • Use shRNA-mediated knockdown of YIF1A with rescue constructs to study function

    • Apply confocal microscopy with antibodies against YIF1A, ER markers (PDI), ERGIC markers (ERGIC53/p58), and Golgi markers (GM130)

    • Quantify co-localization of YIF1A with different organelle markers under various conditions (control vs. VAPB knockdown)

Research indicates that VAPB knockdown neurons display a strong accumulation of YIF1A in the perinuclear region and increased co-localization with Golgi and ERGIC markers, suggesting a role for VAPB in regulating YIF1A recycling between these compartments .

How can quantitative methods be applied to analyze YIF1A immunofluorescence data, and what are the best practices for interpreting results?

Quantitative analysis of YIF1A immunofluorescence data requires sophisticated approaches to accurately measure protein distribution, co-localization, and dynamics:

  • Quantification of subcellular distribution:

    • Intensity profiling: Measure fluorescence intensity along defined linear regions crossing different cellular compartments

    • Compartment segmentation: Define regions of interest (ROIs) corresponding to ER, ERGIC, and Golgi compartments and quantify YIF1A fluorescence intensity in each

    • Distance analysis: Measure the distance of YIF1A puncta from defined cellular landmarks (e.g., nucleus, cell periphery)

  • Co-localization analysis methods:

    • Pearson's correlation coefficient: Measure the pixel-by-pixel correlation between YIF1A and organelle markers (e.g., PDI for ER, ERGIC53/p58 for ERGIC, GM130 for Golgi)

    • Manders' overlap coefficient: Determine the fraction of YIF1A that overlaps with specific organelle markers

    • Object-based co-localization: Count the number of YIF1A-positive puncta that overlap with organelle markers

    Example of co-localization quantification:

    ConditionYIF1A/GM130 Co-localizationYIF1A/ERGIC53 Co-localizationSample Size
    ControlLow (baseline)Partialn > 100
    VAPB KDSignificantly increasedSignificantly increasedn > 100

    Based on data from VAPA/B knockdown studies

  • Dynamic analysis techniques:

    • FRAP (Fluorescence Recovery After Photobleaching): Measure YIF1A mobility by bleaching a defined area and monitoring fluorescence recovery

    • Key parameters: Recovery half-time (t½), mobile fraction, immobile fraction

    • Example finding: VAPB overexpression decreased GFP-YIF1A maximum recovery from ~90% to ~70%, indicating an increase in the immobile fraction

  • Best practices for data interpretation:

    • Multiple independent experiments: Perform at least three independent experiments (>100 cells per condition)

    • Blinded analysis: Have observers blinded to experimental conditions perform quantification

    • Appropriate statistical analysis: Use tests like Student's t-test for pairwise comparisons or ANOVA for multiple conditions

    • Controls for photobleaching: Include non-bleached regions to control for acquisition bleaching during FRAP experiments

    • Standardized imaging parameters: Use consistent exposure times, detector settings, and post-processing steps across all samples

    • Biological context interpretation: Interpret changes in YIF1A distribution in relation to its known function in membrane trafficking between ER and Golgi

When publishing YIF1A immunofluorescence data, it is important to report all image acquisition parameters, quantification methods, and statistical analyses to ensure reproducibility.

What are the differences between analyzing YIF1A in different model systems, and how should antibody selection and validation be adjusted accordingly?

Analyzing YIF1A across different model systems requires careful consideration of species-specific differences and system-appropriate antibody selection:

  • Species-specific considerations:

    • Human vs. rodent systems: While YIF1A is conserved, there are sequence differences that may affect antibody recognition

    • Yeast Yif1p vs. mammalian YIF1A: Despite homology, functional differences exist - mutations that disrupt Yip1p-Yif1p binding in yeast (E89G) do not affect YIF1A function in mammals

    • Cross-reactivity range: Some antibodies show reactivity across multiple species (human, mouse, rat, cow, dog, guinea pig, horse, pig)

  • Cell/tissue-specific considerations:

    • Neurons: YIF1A forms a reticular network with discrete puncta in the cell body and dendrites

    • Non-neuronal cells: YIF1A shows stronger Golgi/ERGIC localization in many cell types

    • Tissue expression patterns: Highest in duodenum and liver, with moderate levels in colon, ovary, pancreas, spleen, and esophagus

  • Model system-specific antibody selection:

    Model SystemRecommended Antibody TypeCritical ValidationApplication Notes
    Human cell linesHuman-specific mAbs or pAbsValidate in human tissue extractsEffective for most applications
    Mouse neuronsCross-reactive or mouse-specific AbsValidate in mouse brain lysatesCritical for dendritic studies
    Yeast (S. cerevisiae)Yif1p-specific antibodiesValidate in yeast lysatesFocus on structural conservation
    Tissue sectionsWell-characterized IHC-validated AbsTest on multiple tissue typesRequires specific fixation protocols
  • System-specific validation approaches:

    • Cell lines: siRNA knockdown followed by Western blot or immunofluorescence

    • Primary neurons: shRNA knockdown with phenotype rescue by resistant constructs

    • Yeast: Use of knockout strains with complementation by mammalian YIF1A

    • Tissues: Compare with established expression patterns and use multiple antibodies against different epitopes

  • Technical adaptations:

    • Fixation protocols: Optimize for each system (4% PFA for neurons, acetone for cell lines)

    • Permeabilization: May need adjustment (0.1% Triton X-100 for cells, 0.3% for tissue sections)

    • Antigen retrieval: Often necessary for formalin-fixed tissues but not for cultured cells

    • Blocking conditions: Serum from the same species as secondary antibody is recommended

When publishing results from multiple model systems, researchers should explicitly state which antibodies were used for each system and how they were validated in that specific context.

What are common issues encountered when using YIF1A antibodies in Western blot applications and how can they be resolved?

Western blot analysis with YIF1A antibodies can present several challenges that require specific troubleshooting approaches:

  • Common issues and solutions:

    IssuePossible CausesSolutions
    No signalDegraded protein, ineffective antibodyUse fresh lysates, include protease inhibitors, verify antibody reactivity
    Multiple bandsCross-reactivity, protein degradation, post-translational modificationsUse more specific antibody, optimize protein extraction, use appropriate negative controls
    High backgroundInsufficient blocking, excessive antibody concentrationIncrease blocking time, titrate antibody, optimize washing steps
    Weak signalLow YIF1A expression, inefficient transferIncrease protein loading, optimize transfer conditions, use signal enhancement systems
    Unexpected molecular weightPost-translational modifications, splice variantsCompare with positive controls, investigate potential modifications
  • Optimization strategies:

    • Sample preparation: YIF1A is a membrane protein with four transmembrane domains , so effective membrane protein extraction buffers containing detergents (e.g., 1% Triton X-100 or RIPA buffer) are essential

    • Protein denaturation: Heat samples at 70°C instead of 95°C to prevent membrane protein aggregation

    • Transfer conditions: Use wet transfer for more efficient transfer of membrane proteins

    • Antibody selection: For Western blot applications, multiple YIF1A antibodies are available with WB validation

  • YIF1A-specific considerations:

    • Expected molecular weight: ~32 kDa for full-length human YIF1A

    • Detection of truncated constructs: When analyzing domain-specific constructs (e.g., YIF1A 131-198), adjust expected molecular weight calculations accordingly

    • Co-detection with interacting partners: When studying interactions with VAPB, consider using dual-color detection systems

  • Validation approaches:

    • Positive controls: Include lysates from cells overexpressing YIF1A

    • Negative controls: Use lysates from cells treated with YIF1A siRNA

    • Verification: If possible, use two independent antibodies targeting different epitopes

How can immunoprecipitation experiments with YIF1A antibodies be optimized to study protein-protein interactions?

Optimizing immunoprecipitation (IP) experiments for YIF1A requires careful consideration of its membrane-embedded nature and interaction properties:

  • Lysis and solubilization considerations:

    • Gentle detergents: Use mild detergents like digitonin (0.5-1%), CHAPS (0.5-1%), or NP-40 (0.5-1%) to solubilize membrane proteins while preserving interactions

    • Buffer composition: Include protease inhibitors, phosphatase inhibitors, and appropriate salt concentration (typically 150mM NaCl)

    • Temperature conditions: Perform lysis and IP steps at 4°C to preserve interactions

  • IP strategies for YIF1A interactions:

    • Direct IP: Using YIF1A antibodies directly coupled to beads

    • Reverse IP: Immunoprecipitating known interaction partners (e.g., VAPB) and detecting YIF1A in the precipitate

    • Tagged constructs: Using epitope-tagged YIF1A (HA, FLAG, GFP) for more specific pulldown

    • Biotin-based approaches: Using biotinylated constructs with streptavidin beads for cleaner pulldowns

  • Approaches shown to be effective in YIF1A studies:

    • Biotin pull-down: Using bio-HA-VAPB to pull down GFP-YIF1A in HEK293T cells

    • Co-immunoprecipitation: Demonstrating interaction between YIF1A and VAPB variants

    • Domain mapping: Using truncated YIF1A constructs to identify interaction regions

  • Controls and validation:

    • Input controls: Check expression levels of both target proteins before IP

    • Negative controls: Use IgG of the same species as the IP antibody

    • Specificity controls: Perform IP after knockdown of YIF1A to confirm specificity

    • Reciprocal IP: Confirm interactions by performing IP in both directions

    • Competition assays: Use excess purified peptide to demonstrate specificity

  • Advanced techniques for challenging interactions:

    • Crosslinking: Use membrane-permeable crosslinkers like DSP or formaldehyde to stabilize transient interactions

    • Proximity labeling: BioID or APEX2 approaches to identify proteins in close proximity to YIF1A

    • Sequential IP: For complex formation analysis, perform tandem purification with different tags

Research has demonstrated that the transmembrane domains of both YIF1A and VAPB are required for their interaction, with the first two transmembrane domains of YIF1A (residues 131-198) showing strongest interaction with VAPB . This knowledge can guide experimental design when studying YIF1A protein interactions.

What are the critical parameters for successful immunofluorescence studies of YIF1A, particularly in neuronal systems?

Successful immunofluorescence studies of YIF1A in neuronal systems require attention to several critical parameters:

  • Sample preparation:

    • Fixation: 4% paraformaldehyde (10-15 minutes at room temperature) preserves YIF1A localization while maintaining neuronal morphology

    • Permeabilization: Mild detergents (0.1-0.3% Triton X-100 or 0.1% saponin) are essential to access the cytoplasmic portions of YIF1A while preserving membrane integrity

    • Blocking: Use 5-10% normal serum from the same species as the secondary antibody to minimize background

  • Antibody selection and validation:

    • Epitope accessibility: Choose antibodies targeting the N-terminal cytosolic domain for better accessibility

    • Specificity verification: Validate using YIF1A knockdown neurons to confirm specific staining

    • Secondary antibodies: Select highly cross-adsorbed secondary antibodies to minimize cross-reactivity in multi-labeling experiments

  • Neuronal-specific considerations:

    • Developmental stage: Mature neurons (DIV16) show robust YIF1A expression and distribution patterns

    • Compartment analysis: Separately analyze cell body versus dendritic regions

    • Co-labeling strategy: Include markers for ER (PDI), ERGIC (ERGIC53/p58), and Golgi (GM130) to fully characterize YIF1A distribution

  • Imaging parameters:

    • Confocal microscopy: Essential for resolving YIF1A distribution in the complex neuronal architecture

    • Z-stack acquisition: Necessary for complete visualization of the three-dimensional distribution of YIF1A

    • Exposure settings: Optimize to prevent saturation while capturing the full dynamic range

    • Resolution: Use appropriate numerical aperture objectives (NA ≥ 1.3) for high-resolution imaging

  • Experimental examples:

    • In DIV16 neurons, YIF1A presents in a reticular network throughout the neuron with discrete puncta in the cell body

    • The reticular YIF1A staining partially co-localizes with endogenous VAPB and ER markers

    • YIF1A-positive puncta in the cell body coincide with the ERGIC

    • VAPA/B knockdown neurons display a consistent change in YIF1A localization, with strong accumulation in the perinuclear region and increased co-localization with Golgi and ERGIC markers

  • Quantification approaches:

    • Co-localization analysis: Quantify overlap between YIF1A and organelle markers using Pearson's or Manders' coefficients

    • Distribution patterns: Measure the relative intensity of YIF1A in different cellular compartments

    • Morphological analysis: Assess effects of YIF1A manipulation on dendritic morphology

These parameters have been successfully applied in studies demonstrating that VAPB knockdown causes redistribution of YIF1A from the ER to post-ER structures in neurons, suggesting a role for VAPB in regulating YIF1A recycling between these compartments .

How do research findings on YIF1A contribute to our understanding of membrane trafficking and neuronal function?

Research on YIF1A using antibody-based approaches has significantly advanced our understanding of membrane trafficking and neuronal function in several key ways:

  • ER-Golgi membrane trafficking regulation:

    • YIF1A functions in the recycling pathway between ER and Golgi compartments

    • VAPB binding regulates YIF1A distribution, retaining it in the ER and inhibiting its recycling into ERGIC and Golgi

    • YIF1A mobility and dynamics are directly influenced by VAPB levels, with VAPB overexpression increasing the immobile fraction of YIF1A molecules in the ER

  • Neuronal membrane trafficking mechanisms:

    • YIF1A is required for intracellular membrane trafficking into dendrites

    • Proper YIF1A function is essential for normal dendritic morphology

    • The interaction between VAPB and YIF1A represents a critical regulatory step in neuronal membrane trafficking

  • Implications for neurodegenerative diseases:

    • VAPB is associated with amyotrophic lateral sclerosis (ALS8)

    • The VAPB-YIF1A interaction may be disrupted in ALS8, potentially contributing to disease pathogenesis

    • Understanding YIF1A function could provide insights into mechanisms of neurodegeneration

  • ER structural maintenance:

    • YIF1A appears to play a role in maintaining ER structure that is separate from its interaction with Yif1A or Rab GTPases

    • Specific mutations in YIF1A (e.g., E95K) disrupt its function in ER structural maintenance

    • The ability of YIF1A to bind its established partners may be uncoupled from its ability to control ER morphology

  • Evolutionary conservation and divergence:

    • Despite homology between yeast Yif1p and mammalian YIF1A, functional differences exist

    • Mutations that disrupt binding in yeast do not necessarily affect function in mammalian systems

    • This suggests evolutionary divergence in the roles of these proteins while maintaining structural conservation

These findings highlight YIF1A as a crucial component of cellular membrane trafficking systems, particularly in neurons, with potential implications for understanding both normal cellular function and disease mechanisms. Antibody-based approaches have been instrumental in revealing these functions by enabling detailed analysis of YIF1A localization, interactions, and dynamics in various cellular contexts.

What are emerging applications of YIF1A antibodies in broader research contexts?

YIF1A antibodies are finding applications beyond basic characterization of the protein, extending into emerging research areas:

  • Neurodegenerative disease research:

    • Investigation of YIF1A-VAPB interactions in ALS8 models

    • Exploration of ER-Golgi trafficking defects in neurodegenerative conditions

    • Analysis of YIF1A distribution in patient-derived neurons or brain samples

  • Developmental neurobiology:

    • Tracking YIF1A expression and localization during neuronal development

    • Investigating its role in dendritic arborization and synaptogenesis

    • Studying potential roles in neuronal polarization and axon specification

  • Cellular stress responses:

    • Monitoring YIF1A dynamics during ER stress conditions

    • Investigating potential roles in unfolded protein response pathways

    • Examining YIF1A in autophagy and secretory pathway stress

  • Advanced imaging applications:

    • Super-resolution microscopy of YIF1A-containing membrane domains

    • Live-cell imaging using YIF1A antibody fragments or nanobodies

    • Correlative light-electron microscopy to define ultrastructural localization

  • Multi-omics integration:

    • Using YIF1A antibodies for ChIP-seq to identify potential transcriptional regulators

    • Combining with proteomics approaches to define the complete YIF1A interactome

    • Integrating with lipidomics to understand lipid-protein interactions in membrane trafficking

  • Therapeutic target validation:

    • Screening for compounds that modulate YIF1A-VAPB interactions

    • Developing targeted approaches to normalize trafficking defects

    • Creating tools to monitor therapeutic efficacy in disease models

As antibody technologies continue to advance, we can expect further refinement of these approaches and development of new applications for studying YIF1A in diverse research contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.