SPAC1002.20 Antibody

What is SPAC1002.20 and why is it studied in research?

SPAC1002.20 is an uncharacterized protein (UniProt ID: Q9C121) from Schizosaccharomyces pombe (strain 972/ATCC 24843), commonly known as fission yeast. The protein consists of 101 amino acids with the sequence: "MTFQRSLRDGFHRLINFYFYPSYHDTVVHNLAFSTSDYIYFKHLTDRNDDALLKVDQTINKTNRFIFRKLKILCPSFLNYSFINIYCFGPYTM" . Despite being uncharacterized, studying this protein is valuable for understanding fundamental biological processes in S. pombe, which serves as an important model organism for eukaryotic cell biology. Investigating uncharacterized proteins like SPAC1002.20 expands our understanding of the S. pombe proteome and potentially reveals new cellular mechanisms and pathways that may have homologs in higher eukaryotes, including humans.

What are the optimal storage conditions for SPAC1002.20 antibody?

For optimal antibody performance and longevity, SPAC1002.20 antibody should be stored at either -20°C or -80°C immediately upon receipt . The antibody is provided in liquid form with a storage buffer consisting of 0.03% Proclin 300 as a preservative, 50% glycerol, and 0.01M PBS at pH 7.4 . It is critical to avoid repeated freeze-thaw cycles as these can significantly degrade antibody quality and performance. For researchers conducting extended studies, consider aliquoting the antibody into single-use volumes before freezing to minimize repeated thawing of the entire stock. When temporarily storing during experiment day, keep the antibody on ice or at 4°C, but return to -20°C or -80°C for long-term storage as soon as possible to maintain binding efficacy.

What are the validated applications for SPAC1002.20 antibody?

The SPAC1002.20 antibody has been validated for specific research applications through rigorous testing protocols. The primary validated applications include:

These applications have been validated specifically for detecting the SPAC1002.20 protein from Schizosaccharomyces pombe (strain 972/ATCC 24843) . When implementing these techniques, researchers should perform preliminary titration experiments to determine the optimal antibody concentration for their specific experimental conditions, as factors such as sample preparation, detection method, and equipment can influence performance.

How should cross-reactivity testing be designed when working with SPAC1002.20 antibody in related yeast species?

When investigating potential cross-reactivity of the SPAC1002.20 antibody with proteins from related yeast species, a systematic experimental approach is essential. Although this antibody is raised against S. pombe SPAC1002.20 protein specifically , homologous proteins in related species may share epitopes. Drawing from approaches used in antibody characterization studies like those for SARS-CoV-2, researchers should:

• Perform sequence alignment analysis of the SPAC1002.20 protein with potential homologs in related yeast species to identify regions of conservation.

• Express recombinant versions of these homologous proteins (if available) for controlled testing.

• Design a multi-phase experimental validation:

  • Initial screening via dot blot or Western blot analysis using purified proteins

  • Secondary validation using whole cell lysates from different yeast species

  • Confirmatory testing using immunofluorescence microscopy to assess subcellular localization patterns

This methodological approach mirrors that used in cross-reactivity studies of mAbs against SARS-CoV variants, where sequence alignment was used to identify conserved regions before functional testing . Document all cross-reactivity results in a comprehensive table comparing signal intensity across species to establish specificity boundaries for the antibody.

What advanced epitope mapping strategies can be employed to precisely characterize SPAC1002.20 antibody binding sites?

For precise characterization of epitope binding sites for the SPAC1002.20 polyclonal antibody, researchers should employ a multi-technique approach similar to those used in advanced immunological studies. Drawing from methodologies used in SARS-CoV-2 antibody characterization , an effective epitope mapping strategy would include:

• Peptide Array Analysis: Synthesize overlapping peptides (typically 15-20 amino acids with 5-10 amino acid overlaps) spanning the entire 101 amino acid sequence of SPAC1002.20 protein. This approach can identify linear epitopes recognized by the antibody.

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify conformational epitopes by measuring deuterium uptake differences in the presence and absence of the antibody.

• Site-Directed Mutagenesis: Generate a panel of SPAC1002.20 variants with point mutations throughout the sequence and test antibody binding to identify critical residues.

• X-ray Crystallography or Cryo-EM: For the most precise epitope mapping, co-crystallize the antibody with the antigen or use Cryo-EM to visualize the binding interface at atomic resolution.

This multi-technique approach provides complementary data that together create a comprehensive map of antibody binding sites, helping to explain potential cross-reactivity patterns and guiding future antibody engineering efforts.

What are the most common causes of background signal when using SPAC1002.20 antibody in immunoblotting, and how can they be mitigated?

Background issues in immunoblotting with SPAC1002.20 antibody often stem from several key factors that can be systematically addressed through protocol optimization. The polyclonal nature of this antibody requires particular attention to specificity controls. The most common causes and their solutions include:

Implementation of a systematic troubleshooting approach is essential when optimizing experimental conditions. Researchers should modify one variable at a time while keeping others constant to accurately identify the source of background issues. Additionally, pre-adsorption of the antibody with non-specific proteins (e.g., other yeast proteins) can sometimes reduce background by depleting cross-reactive antibodies from the polyclonal mixture.

How can SPAC1002.20 antibody performance be validated in new experimental systems or following protocol modifications?

When implementing SPAC1002.20 antibody in new experimental systems or after protocol modifications, a structured validation approach is necessary to ensure reliable results. Drawing from best practices in antibody validation , researchers should:

• Positive and Negative Controls: Include recombinant SPAC1002.20 protein as a positive control and lysates from SPAC1002.20 knockout S. pombe strains (if available) as negative controls.

• Reproducibility Testing: Perform at least three independent experiments with technical replicates to assess consistency.

• Specificity Assessment:

  • Conduct a peptide competition assay using the immunizing peptide

  • Evaluate detection of a single band of expected molecular weight (~11 kDa) on Western blots

  • Confirm absence of signal in non-expressing cells or tissues

• Sensitivity Determination: Create a standard curve using purified recombinant SPAC1002.20 protein to establish detection limits across concentration ranges (typically 0.1-100 ng).

• Cross-validation: Compare results from multiple detection methods (e.g., ELISA vs. Western blot) to verify consistent detection patterns.

This methodical validation process ensures that any modifications to established protocols do not compromise antibody performance and provides confidence in the reliability of experimental results.

What are the best approaches for quantitative analysis of SPAC1002.20 expression across different experimental conditions?

For rigorous quantitative analysis of SPAC1002.20 expression, researchers should implement a multi-faceted approach combining complementary techniques. Based on practices from similar protein expression studies , the following methodology is recommended:

• Western Blot Densitometry:

  • Use image analysis software (ImageJ, ImageLab) to quantify band intensity

  • Normalize to appropriate loading controls (e.g., actin, GAPDH) for each sample

  • Include a standard curve of recombinant SPAC1002.20 protein on each blot

  • Apply statistical analysis across biological replicates (minimum n=3)

• ELISA Quantification:

  • Develop a sandwich ELISA using the validated SPAC1002.20 antibody

  • Create standard curves using recombinant SPAC1002.20 protein

  • Implement four-parameter logistic regression for curve fitting

  • Ensure samples fall within the linear range of detection

• Data Integration:

  • Correlate results from different quantification methods

  • Apply appropriate statistical tests (t-test, ANOVA) depending on experimental design

  • Report fold-changes relative to control conditions with standard error

• Visualization:

  • Present data in both tabular and graphical formats

  • Include error bars representing standard deviation or standard error

  • Use consistent scales when comparing across experiments

How can researchers distinguish between specific signal and artifacts when using SPAC1002.20 antibody in complex cellular extracts?

Distinguishing genuine SPAC1002.20 signals from artifacts in complex cellular extracts requires implementation of rigorous validation controls and analytical techniques. Drawing from antibody validation practices described in immunological research , the following approach is recommended:

• Essential Controls:

  • Include lysate from SPAC1002.20 knockout strains (negative control)

  • Add recombinant SPAC1002.20 protein as positive control

  • Perform secondary antibody-only controls to identify non-specific binding

  • Include pre-immune serum controls when available

• Sequential Validation:

  • Confirm molecular weight correspondence (expected ~11 kDa for SPAC1002.20)

  • Verify detection is abolished by pre-incubation with immunizing antigen

  • Compare detection patterns across different extraction methods

• Advanced Confirmation:

  • Implement orthogonal detection methods (mass spectrometry identification of immunoprecipitated proteins)

  • Correlate protein levels with mRNA expression data when available

  • Use multiple antibodies targeting different epitopes of SPAC1002.20 (if available)

• Signal Quantification:

  • Establish signal-to-noise ratio thresholds (typically >3:1 for reliable detection)

  • Apply statistical methods to differentiate significant signals from background

  • Document all parameters systematically for reproducibility

By implementing this structured analytical framework, researchers can confidently distinguish between genuine SPAC1002.20 signals and experimental artifacts, ensuring the validity and reliability of their experimental findings.

What are the critical parameters to optimize when designing immunoprecipitation experiments with SPAC1002.20 antibody?

Successful immunoprecipitation (IP) experiments with SPAC1002.20 antibody require careful optimization of multiple parameters. Though the antibody is primarily validated for ELISA and Western blot applications , the following strategy can guide adaptation for IP protocols:

For SPAC1002.20 antibody specifically, researchers should note that as a polyclonal IgG raised in rabbit , it should bind effectively to protein A or protein A/G beads. Preliminary experiments should include positive controls with recombinant SPAC1002.20 protein spiked into lysates to confirm antibody capture efficiency under various conditions, followed by assessment of endogenous protein capture from yeast extracts.

How should researchers design studies to investigate potential post-translational modifications of SPAC1002.20 using the available antibody?

Investigating post-translational modifications (PTMs) of SPAC1002.20 requires a carefully structured experimental approach that leverages the specificity of the antibody while incorporating complementary analytical techniques. The following research design strategy is recommended:

• Initial Assessment:

  • Perform high-resolution SDS-PAGE with the SPAC1002.20 antibody to identify potential mobility shifts indicative of PTMs

  • Use Phos-tag gels specifically to detect phosphorylation events

  • Compare migration patterns under various growth conditions and stress responses

• PTM-Specific Enrichment:

  • Implement immunoprecipitation with SPAC1002.20 antibody followed by:

    • Phospho-specific antibody probing (Western blot)

    • Ubiquitin/SUMO antibody detection for modification status

    • Glycosylation-specific staining methods

• Mass Spectrometry Analysis:

  • Perform immunoprecipitation with SPAC1002.20 antibody

  • Process samples for LC-MS/MS analysis

  • Analyze data using PTM-specific search parameters

  • Validate identified PTM sites with targeted MS approaches (PRM or MRM)

• Functional Validation:

  • Generate site-specific mutants (e.g., S/T to A for phosphorylation sites)

  • Compare antibody recognition of wild-type vs. mutant proteins

  • Assess functional consequences through phenotypic analysis

This integrated approach combines the specificity of the SPAC1002.20 antibody with advanced analytical techniques to comprehensively characterize potential PTMs and their functional significance. Researchers should be aware that some PTMs might affect epitope recognition by the antibody, potentially requiring complementary detection methods for complete PTM profiling.

How does the performance of polyclonal SPAC1002.20 antibody compare with monoclonal alternatives in various research applications?

While specific monoclonal alternatives for SPAC1002.20 are not widely documented in the provided search results, a comparative analysis based on antibody development principles can guide researchers in understanding the relative advantages of each format. The current SPAC1002.20 antibody is a rabbit polyclonal antibody , which offers certain performance characteristics that can be contrasted with theoretical monoclonal alternatives:

The decision between polyclonal and monoclonal antibodies should be guided by the specific research objectives. For preliminary characterization of SPAC1002.20, the current polyclonal antibody offers advantages through multi-epitope recognition. Future development of monoclonal alternatives would be valuable for applications requiring higher specificity and reproducibility, particularly for studies involving specific functional domains or precise epitope targeting.

What are the emerging applications and future research directions for SPAC1002.20 antibody in fission yeast biology?

The SPAC1002.20 antibody represents an important tool for investigating an uncharacterized protein in S. pombe, with several promising future research directions and emerging applications:

• Functional Characterization Studies:

  • Combining antibody-based localization with CRISPR-based gene editing to correlate SPAC1002.20 localization with function

  • Utilizing the antibody in ChIP-seq if SPAC1002.20 shows nuclear localization to identify potential DNA binding regions

  • Implementing BioID or proximity labeling approaches with SPAC1002.20 antibody validation to map protein interaction networks

• Stress Response Investigations:

  • Monitoring SPAC1002.20 expression and modification patterns under various cellular stresses (oxidative, temperature, nutrient)

  • Correlating protein levels with transcriptional changes to identify regulatory mechanisms

  • Examining protein stability and turnover rates under different conditions

• Comparative Studies Across Yeast Species:

  • Investigating potential homologs in related species using cross-reactivity testing

  • Developing evolutionary models of protein function based on conservation patterns

  • Creating a foundation for translational studies if human homologs are identified

• Technical Advancements:

  • Developing super-resolution microscopy protocols with the antibody for precise localization studies

  • Creating SPAC1002.20 biosensors by coupling antibody-based detection with fluorescent reporters

  • Implementing single-cell analysis techniques to examine cell-to-cell variation in protein expression

The advancement of these research directions would benefit from further antibody characterization, including the development of monoclonal versions targeting specific epitopes and validation across additional applications such as immunofluorescence and chromatin immunoprecipitation.