YJEFN3 Antibody

What is YJEFN3 and why is it important in research?

YJEFN3 is predicted to enable NADHX epimerase activity and is involved in several critical biological processes. According to GeneCards, YJEFN3 may accelerate cholesterol efflux from endothelial cells to high-density lipoprotein (HDL) and thereby regulate angiogenesis . The protein also orchestrates hematopoietic stem and progenitor cell emergence from the hemogenic endothelium, with YJEFN3-mediated cholesterol efflux activating endothelial SREBF2, which in turn transactivates NOTCH and promotes hematopoietic stem and progenitor cell emergence . Additionally, it may play roles in spermiogenesis and oogenesis . These diverse functions make YJEFN3 an important target for research in vascular biology, hematopoiesis, and reproductive science.

What applications are YJEFN3 antibodies most commonly used for?

YJEFN3 antibodies are primarily utilized in the following research applications:

• Immunohistochemistry (IHC): Typically at dilutions of 1:50-1:200 for tissue localization studies

• Immunofluorescence (IF): Used at concentrations of 0.25-2 μg/mL for subcellular localization studies

• Western Blotting (WB): For protein detection and quantification

• Enzyme-Linked Immunosorbent Assay (ELISA): For quantitative measurement of YJEFN3 in samples

• Antibody Production (AbP): As immunogens for generating new antibodies

These techniques enable researchers to study YJEFN3 expression patterns, subcellular localization, protein interactions, and functional roles in various biological contexts.

How do I determine the optimal working concentration for a YJEFN3 antibody in my experiments?

Determining the optimal working concentration for a YJEFN3 antibody requires a systematic titration approach:

• Start with the manufacturer's recommended dilution range (e.g., 1:50-1:200 for IHC or 0.25-2 μg/mL for IF)

• Perform a dilution series experiment using positive control samples known to express YJEFN3

• Include appropriate negative controls (samples known not to express YJEFN3 or secondary antibody-only controls)

• Evaluate signal-to-noise ratio at each concentration

• Select the dilution that provides maximum specific signal with minimal background

• Validate this concentration across multiple experimental replicates before proceeding with full studies

This methodical approach ensures reproducible results and prevents wastage of valuable antibody and research samples.

What are the best tissue fixation and antigen retrieval methods when using YJEFN3 antibodies for immunohistochemistry?

When performing immunohistochemistry with YJEFN3 antibodies, consider the following protocol:

Fixation:

• 10% neutral buffered formalin is typically effective for YJEFN3 detection

• Fixation time should be optimized (generally 24-48 hours) to prevent overfixation which can mask epitopes

Antigen Retrieval Methods:

• Heat-induced epitope retrieval (HIER) is recommended

• Options include:

  • Citrate buffer (pH 6.0) - most commonly effective for YJEFN3

  • EDTA buffer (pH 9.0) - may provide stronger signal in some tissue types

  • Tris-EDTA buffer (pH 9.0) - alternative for difficult samples

Protocol Optimization:

• Test multiple retrieval conditions in parallel

• For the Human Protein Atlas antibodies (like HPA060789), follow their validated protocols which have been tested across multiple tissue types

• Monitor retrieval time carefully, as excessive heating can damage tissue morphology

The optimal method may vary depending on tissue type and the specific YJEFN3 epitope targeted by your antibody.

How should I validate the specificity of a YJEFN3 antibody for my research?

A comprehensive validation strategy for YJEFN3 antibodies should include:

• Positive and negative controls:

  • Use tissues/cells known to express or lack YJEFN3

  • The Human Protein Atlas provides expression data across 44 normal human tissues

• Molecular weight verification:

  • Run Western blot to confirm the antibody detects a protein of the expected size

  • YJEFN3 should appear at approximately 33-35 kDa

• Multiple antibody validation:

  • Use at least two different antibodies targeting different epitopes of YJEFN3

  • Compare staining patterns for consistency

• Knockdown/knockout experiments:

  • Use siRNA, shRNA, or CRISPR-Cas9 to reduce YJEFN3 expression

  • Confirm corresponding reduction in antibody signal

• Peptide competition assay:

  • Pre-incubate antibody with the immunizing peptide (e.g., the PrEST antigen sequence SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD)

  • Specific binding should be blocked by the peptide

• Recombinant protein controls:

  • Use purified recombinant YJEFN3 protein as positive control

  • Test cross-reactivity with closely related proteins, particularly NAXE (paralog of YJEFN3)

How can I study the protein-protein interactions of YJEFN3 using antibody-based approaches?

To investigate YJEFN3 protein interactions, consider these methodological approaches:

Co-Immunoprecipitation (Co-IP):

• Use validated anti-YJEFN3 antibodies (e.g., HPA060789) to pull down YJEFN3 and its interacting partners

• Known interactions, such as YJEFN3-UBR3 , can serve as positive controls

• Verify results with reciprocal Co-IP using antibodies against suspected interacting partners

Proximity Ligation Assay (PLA):

• Use pairs of antibodies against YJEFN3 and potential interacting proteins

• This technique allows visualization of protein interactions (<40nm proximity) in situ

• Particularly useful for confirming interactions in their native cellular context

Bimolecular Fluorescence Complementation (BiFC):

• Create fusion constructs of YJEFN3 and potential partners with split fluorescent protein fragments

• Interaction brings fragments together, restoring fluorescence

• Allows real-time monitoring of interactions in living cells

Crosslinking Immunoprecipitation (CLIP):

• Particularly useful if YJEFN3 interacts with nucleic acids

• Use UV crosslinking followed by immunoprecipitation with YJEFN3 antibodies

• Identify bound nucleic acids by sequencing

Mass Spectrometry-Based Approaches:

• Immunoprecipitate YJEFN3 using specific antibodies

• Identify co-precipitating proteins by mass spectrometry

• BioPlex 3.0 has previously identified a YJEFN3-UBR3 interaction using this approach with a CompPASS score of 0.923078234

What are the considerations for using YJEFN3 antibodies in studying its role in cholesterol efflux and angiogenesis?

When investigating YJEFN3's role in cholesterol efflux and angiogenesis, consider these experimental approaches:

Cholesterol Efflux Studies:

• Use YJEFN3 antibodies for immunofluorescence co-localization with cholesterol transporters and HDL receptors

• Combine with functional assays:

  • Measure cholesterol efflux using fluorescently labeled cholesterol in cells with varied YJEFN3 expression

  • Use YJEFN3 antibodies to immunodeplete the protein from cell lysates to assess direct effects on efflux mechanisms

Angiogenesis Research:

• Tissue section analysis:

  • Perform dual immunostaining with YJEFN3 and endothelial markers (CD31, vWF)

  • Quantify YJEFN3 expression in relation to vascular density and morphology

• In vitro angiogenesis models:

  • Use YJEFN3 antibodies to track protein expression during tube formation assays

  • Combine with YJEFN3 inhibition/overexpression to assess functional impacts

Mechanistic Studies:

• Investigate SREBF2 pathway connections:

  • Use chromatin immunoprecipitation (ChIP) with YJEFN3 antibodies to identify potential chromatin interactions

  • Perform co-immunoprecipitation to detect YJEFN3-SREBF2 complexes

• NOTCH pathway analysis:

  • Dual immunostaining for YJEFN3 and NOTCH pathway components

  • Use neutralizing YJEFN3 antibodies to block function and assess impact on NOTCH signaling

Technical Considerations:

• For cell-based assays, confirm antibody doesn't interfere with protein function

• Use cell-permeable antibodies for live-cell studies of YJEFN3 dynamics during cholesterol flux

• Consider both acute (antibody-mediated) and chronic (genetic) manipulation of YJEFN3 to distinguish direct vs. compensatory effects

How do I design experiments to study YJEFN3's subcellular localization and trafficking?

To investigate YJEFN3's subcellular localization and potential trafficking:

Immunofluorescence Microscopy Protocol:

• Prepare cells/tissues using optimal fixation (4% paraformaldehyde for cells, formalin for tissues)

• Permeabilize with 0.1-0.5% Triton X-100 (adjust based on compartment accessibility)

• Block with 5% serum/BSA (1 hour at room temperature)

• Incubate with primary anti-YJEFN3 antibody (0.25-2 μg/mL, overnight at 4°C)

• Apply fluorophore-conjugated secondary antibody (1-2 hours at room temperature)

• Counterstain with organelle markers:

  • Mitochondria: MitoTracker or anti-COX IV

  • ER: anti-calnexin or anti-PDI

  • Golgi: anti-GM130

  • Nucleus: DAPI or Hoechst 33342

• Image using confocal microscopy for optimal resolution of subcellular structures

Live-Cell Imaging Approach:

• Generate YJEFN3-fluorescent protein fusions (e.g., YJEFN3-GFP)

• Transfect cells and verify construct expression by Western blot using YJEFN3 antibodies

• Use spinning disk confocal microscopy for time-lapse imaging

• Track protein movement in response to stimuli known to affect cholesterol efflux

Biochemical Fractionation Method:

• Separate cellular compartments via differential centrifugation

• Analyze fractions by Western blot using anti-YJEFN3 antibodies

• Compare to compartment-specific markers (e.g., VDAC for mitochondria, Lamin B1 for nucleus)

• Quantify relative distribution across compartments

Advanced Techniques:

• Super-resolution microscopy (STORM, PALM) with directly labeled YJEFN3 antibodies for nanoscale localization

• Electron microscopy immunogold labeling for ultrastructural localization

• FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility within compartments

How do I troubleshoot high background or non-specific staining when using YJEFN3 antibodies?

When encountering high background or non-specific staining with YJEFN3 antibodies, implement this systematic troubleshooting approach:

Common Causes and Solutions:

Optimization Strategies:

• Antibody validation - confirm specificity using the approaches in question 2.2

• Titrate primary antibody concentration (start with 0.25 μg/mL and adjust)

• Reduce incubation temperature (4°C overnight instead of room temperature)

• Try different detection systems (HRP/AP/fluorophore)

• For tissues, consider antigen retrieval optimization

Control Experiments:

• Omit primary antibody (secondary-only control)

• Use isotype control antibody at same concentration

• Pre-adsorb antibody with immunizing peptide (SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD)

• Include known positive and negative tissue/cell controls

These methodical approaches help distinguish true YJEFN3 signal from technical artifacts, ensuring reliable experimental outcomes.

What are the best storage conditions for maintaining YJEFN3 antibody activity over time?

To maximize shelf life and maintain consistent performance of YJEFN3 antibodies:

Optimal Storage Conditions:

Stability Monitoring Protocol:

• Set aside control aliquots from each antibody lot

• Test activity periodically (every 3-6 months) using consistent positive control samples

• Record any sensitivity or specificity changes over time

• Consider implementing antibody validation checkpoints in long-term studies

Special Considerations for Different Antibody Formats:

• For conjugated antibodies (fluorophore/enzyme-linked), protect from light

• For low concentration antibodies (<0.1 mg/mL), consider adding carrier protein (BSA 1-5 mg/mL)

• For antibody fragments (Fab, scFv), increase glycerol to 20% and avoid repeated freeze-thaw

Warning Signs of Antibody Deterioration:

• Visible precipitates or cloudiness in solution

• Decreased signal intensity at same concentration

• Increased background or non-specific binding

• Shift in molecular weight band pattern on Western blots

Proper storage and handling significantly improve experimental reproducibility and reduce reagent costs over time.

How do polyclonal and monoclonal YJEFN3 antibodies compare in different research applications?

When selecting between polyclonal and monoclonal YJEFN3 antibodies, consider these comparative aspects:

Application-Specific Recommendations:

• Western Blotting:

  • Polyclonal antibodies often provide stronger signals and work well with denatured proteins

  • For quantitative Western blots, monoclonals provide more consistent results

• Immunohistochemistry:

  • Polyclonals like HPA060789 are well-validated for tissue staining patterns

  • For chromogenic IHC, polyclonals may provide better signal amplification

• Immunoprecipitation:

  • Consider using a combination approach: immunoprecipitate with monoclonal and detect with polyclonal

  • Test efficiencies empirically as epitope accessibility in native conditions varies

• Flow Cytometry:

  • Monoclonals generally preferred for their specificity and defined epitope

• Proximity Ligation Assays:

  • Using antibodies from different host species facilitates dual recognition

  • Matching rabbit polyclonal anti-YJEFN3 with mouse monoclonal anti-interacting protein

For comprehensive YJEFN3 studies, maintaining both polyclonal and monoclonal antibodies in your toolkit provides complementary advantages.

What are the latest advanced techniques for studying YJEFN3 using antibody-based approaches?

Cutting-Edge Methodologies for YJEFN3 Research:

• Spatial Transcriptomics with Antibody Validation:

  • Combine in situ transcriptomics with YJEFN3 antibody staining

  • Correlate protein expression with mRNA localization

  • Validate YJEFN3 expression patterns in tissue microenvironments

• Proximity-Based Biotinylation (BioID/TurboID):

  • Fuse YJEFN3 to promiscuous biotin ligase

  • Identify proteins in close proximity to YJEFN3 in living cells

  • Validate interactions using conventional antibody-based co-IP

  • Particularly useful for mapping YJEFN3's role in cholesterol efflux complexes

• Super-Resolution Microscopy:

  • Apply STORM, PALM or STED microscopy with directly-labeled YJEFN3 antibodies

  • Achieve sub-diffraction resolution (~20nm) of YJEFN3 distribution

  • Particularly valuable for co-localization with membrane microdomains

• Mass Cytometry (CyTOF) Applications:

  • Label anti-YJEFN3 antibodies with rare earth metals

  • Combine with >40 other markers for high-dimensional analysis

  • Map YJEFN3 expression in complex tissues like hemogenic endothelium

• CRISPR Knock-In Epitope Tags:

  • Endogenously tag YJEFN3 with small epitopes (FLAG, HA, V5)

  • Use well-validated commercial antibodies against these tags

  • Avoids potential issues with anti-YJEFN3 antibody specificity

  • Enables ChIP-seq studies if YJEFN3 has chromatin interactions

• Single-Molecule Tracking:

  • Label YJEFN3 antibodies with quantum dots or organic fluorophores

  • Track individual YJEFN3 molecules in living cells

  • Analyze diffusion patterns to determine membrane vs. cytoplasmic behavior

• Microfluidics-Based Antibody Arrays:

  • Create microfluidic devices with spatially-resolved anti-YJEFN3 capture

  • Study secretion dynamics in single cells

  • Pair with proteomic analysis of captured material

These advanced techniques extend beyond conventional antibody applications and offer unprecedented insights into YJEFN3 biology, particularly its dynamic roles in cholesterol metabolism and hematopoietic stem cell regulation.

How can YJEFN3 antibodies be used to investigate its potential roles in disease mechanisms?

Given YJEFN3's predicted functions in cholesterol efflux, angiogenesis regulation, and hematopoietic stem cell processes , antibody-based approaches can illuminate its roles in disease:

Cardiovascular Disease Research:

• Atherosclerosis Studies:

  • Immunohistochemistry of human atherosclerotic plaques with YJEFN3 antibodies

  • Quantify YJEFN3 expression relative to plaque stability markers

  • Correlate with cholesterol efflux capacity in patient-derived macrophages

• Angiogenesis in Ischemic Disease:

  • Use YJEFN3 antibodies to assess expression in models of peripheral or myocardial ischemia

  • Analyze co-localization with angiogenic factors (VEGF, angiopoietins)

  • Test function-blocking YJEFN3 antibodies in angiogenesis assays

Hematological Disorders:

• Stem Cell Disorders Protocol:

  • Multi-parameter flow cytometry with YJEFN3 antibodies to analyze HSC populations

  • Sort YJEFN3-high vs. YJEFN3-low populations and assess functional properties

  • Immunostain bone marrow biopsies from patients with HSC disorders

• Leukemia Research Applications:

  • Profile YJEFN3 expression across leukemia subtypes using tissue microarrays

  • Correlate with NOTCH pathway activation markers

  • Investigate YJEFN3-SREBF2-NOTCH axis in leukemic transformation

Reproductive Health Studies:

• Given YJEFN3's potential role in spermiogenesis and oogenesis :

  • Immunohistochemistry of testicular and ovarian tissues

  • Compare expression patterns in normal vs. pathological samples

  • Correlate with markers of gametogenesis and fertility

Cancer Research:

• Tumor Angiogenesis:

  • Dual immunostaining for YJEFN3 and tumor vasculature markers

  • Quantitative image analysis of YJEFN3 distribution relative to vascular normalization

  • Correlate with response to anti-angiogenic therapies

• Cholesterol Metabolism in Tumors:

  • Analyze YJEFN3 expression in lipid-dependent vs. lipid-independent tumors

  • Investigate correlation with cholesterol synthesis enzymes (HMGCR, SREBF2)

  • Use neutralizing YJEFN3 antibodies in tumor spheroid models

Methodological Approach for Biomarker Evaluation:

• Tissue microarrays with anti-YJEFN3 antibodies across disease states

• Quantitative image analysis using digital pathology tools

• Correlation with clinical outcomes and molecular profiling data

• Validation in independent patient cohorts

These methodologies leverage antibody-based detection to illuminate YJEFN3's role in disease pathogenesis, potentially identifying new therapeutic targets or biomarkers.

What are emerging areas of research related to YJEFN3 where antibody development is needed?

Based on current knowledge of YJEFN3's functions and the available antibody tools, several emerging research areas would benefit from new antibody development:

Priority Areas for YJEFN3 Antibody Development:

• Phospho-Specific Antibodies:

  • Develop antibodies recognizing potential phosphorylation sites on YJEFN3

  • Enable studies of post-translational regulation of YJEFN3 function

  • Application in signaling pathway analysis during cholesterol efflux

• Domain-Specific Antibodies:

  • Generate antibodies targeting specific functional domains:

    • N-terminal YjeF domain - linked to metabolic functions

    • Regions mediating interaction with cholesterol transport machinery

    • UBR3-interacting regions

  • Use for domain-specific functional blocking studies

• Conformation-Specific Antibodies:

  • Develop antibodies that recognize active vs. inactive YJEFN3 conformations

  • Enable monitoring of YJEFN3 activation states in situ

  • Particularly valuable for studying dynamic changes during hematopoietic stem cell emergence

• Cross-Species Reactive Antibodies:

  • Create antibodies recognizing conserved epitopes across model organisms

  • Enable comparative studies in mouse models (81% homology) , zebrafish, and other systems

  • Facilitate evolutionary studies of YJEFN3 function

• Intrabodies and Nanobodies:

  • Develop intracellularly expressed antibody fragments (intrabodies)

  • Target YJEFN3 in specific subcellular compartments

  • Use for acute disruption of function in live cells

Technical Innovations Needed:

Collaborative Research Opportunities:

• Combine antibody development with CRISPR-based genomic tagging

• Integrate with emerging spatial proteomics technologies

• Link YJEFN3 dynamics to cholesterol metabolism pathways

Advancement in these antibody tools would significantly accelerate understanding of YJEFN3's roles in normal physiology and disease states.

How can artificial intelligence and computational approaches enhance YJEFN3 antibody validation and application?

Integrating AI and computational methods with YJEFN3 antibody research creates powerful new research capabilities:

AI-Enhanced Antibody Validation:

• Epitope Prediction and Optimization:

  • Apply machine learning to predict optimal YJEFN3 epitopes for antibody generation

  • Identify regions with high antigenicity but low cross-reactivity with related proteins (e.g., NAXE)

  • Design synthetic peptides with maximized immunogenicity

• Automated Image Analysis:

  • Implement deep learning for objective quantification of YJEFN3 immunostaining

  • Train neural networks to recognize subcellular localization patterns

  • Enable consistent scoring across large tissue datasets

• Cross-Reactivity Prediction:

  • Use sequence similarity networks to identify potential cross-reactive proteins

  • Predict off-target binding before experimental validation

  • Design validation panels to test predicted cross-reactivities

Computational Applications for YJEFN3 Research:

• Structural Modeling and Epitope Mapping:

  • Generate 3D models of YJEFN3 protein structure

  • Map antibody binding sites to predict functional impact

  • Design antibodies targeting specific functional domains

• Network Analysis:

  • Integrate protein interaction data (e.g., YJEFN3-UBR3) with expression datasets

  • Build predictive models of YJEFN3 function in different contexts

  • Identify high-value targets for co-immunoprecipitation validation

• Single-Cell Data Integration:

  • Correlate antibody-based YJEFN3 protein measurements with scRNA-seq data

  • Identify cell populations with discordant mRNA/protein expression

  • Map YJEFN3 protein expression onto cellular trajectories (especially relevant for hematopoietic development)

Emerging AI-Driven Methodologies:

Implementation Strategy:

• Begin with available AI tools for image analysis of YJEFN3 immunostaining

• Advance to integrated multiomics approaches incorporating antibody-based data

• Ultimately develop custom AI solutions for YJEFN3-specific research questions

These computational approaches promise to enhance the value of antibody-based studies by providing context, quantitation, and mechanistic insights that would be difficult to obtain through traditional methods alone.

What are the most critical factors to consider when selecting and applying YJEFN3 antibodies for specific research questions?

When selecting and applying YJEFN3 antibodies, consider these critical decision factors:

Research Question-Based Selection Guide:

• Epitope Consideration:

  • For structural/functional studies: Select antibodies targeting domains of interest

  • For general detection: Choose antibodies against well-conserved regions

  • The PrEST antigen sequence (SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD) represents one validated epitope region

• Application Compatibility:

  • For native protein detection (IP, IF): Antibodies recognizing conformational epitopes

  • For denatured protein (WB, IHC): Antibodies targeting linear epitopes

  • Multi-application validated antibodies like HPA060789 offer versatility

• Validation Status:

  • Prioritize antibodies with application-specific validation

  • Human Protein Atlas antibodies undergo extensive cross-validation

  • Consider antibodies tested in knockout/knockdown systems

• Host Species Considerations:

  • For multiplex staining: Select antibodies raised in different host species

  • For in vivo studies: Consider potential immunogenicity issues

  • For co-staining with mouse tissue: Avoid mouse-derived primary antibodies

Experimental Design Decision Matrix:

Checklist Before Proceeding:

• Verify the antibody has been validated for your specific application

• Confirm species reactivity matches your experimental system

• Check for potential cross-reactivity with related proteins (especially NAXE)

• Review literature for reported successes/limitations with specific antibodies

• Consider generating complementary data with alternative detection methods

This comprehensive approach to antibody selection ensures optimal experimental outcomes and increases confidence in research findings related to YJEFN3 biology.

What statistical approaches are recommended for analyzing YJEFN3 antibody-based experimental data?

Statistical Methods by Experiment Type:

• Immunohistochemistry/Immunofluorescence Analysis:

  • Scoring Approach:

    • Use semi-quantitative scoring (0/1+/2+/3+) or H-score (0-300) for intensity

    • Implement automated image analysis for objective quantification

  • Statistical Tests:

    • For comparing groups: Mann-Whitney U (2 groups) or Kruskal-Wallis (>2 groups)

    • For correlations with clinical data: Spearman's rank correlation

    • For survival analysis: Kaplan-Meier with log-rank test

• Western Blot Quantification:

  • Normalization Strategy:

    • Always normalize YJEFN3 to appropriate loading controls (β-actin, GAPDH)

    • Consider using total protein normalization (Ponceau, REVERT)

  • Statistical Tests:

    • Two-group comparisons: Student's t-test or Mann-Whitney U test

    • Multiple group comparisons: ANOVA with appropriate post-hoc tests

    • Time-course experiments: Repeated measures ANOVA

• Co-localization Analysis:

  • Quantitative Metrics:

    • Pearson's correlation coefficient for intensity correlation

    • Manders' overlap coefficient for proportional overlap

    • Object-based methods for discrete structures

  • Statistical Approach:

    • Compare coefficients across experimental conditions using appropriate parametric/non-parametric tests

    • Implement permutation tests to establish significance thresholds

• Proximity Ligation Assay:

  • Quantification Method:

    • Count discrete puncta per cell using automated image analysis

    • Measure intensity when signals are diffuse

  • Statistical Analysis:

    • Compare dot counts using appropriate count data statistics (Poisson regression)

    • Use mixed models to account for within-sample correlation

Sample Size and Power Considerations:

Advanced Statistical Approaches:

• Bootstrapping for generating confidence intervals with small sample sizes

• Bayesian approaches for integrating prior knowledge about YJEFN3 expression

• Machine learning for pattern recognition in complex YJEFN3 expression datasets

• Meta-analysis approaches when combining data from multiple antibodies

Reporting Standards:

• Always report exact p-values rather than thresholds

• Include effect sizes alongside significance tests

• Clearly state normality testing and justification for parametric/non-parametric approaches

• Include representative images alongside quantitative data