The YLR294C antibody is a research tool designed to detect the YLR294C protein, a gene product in Saccharomyces cerevisiae (baker’s yeast). This antibody has applications in molecular biology, particularly in studying yeast cellular processes. Below is a detailed analysis of its development, specifications, and research applications.
YLR294C encodes a putative uncharacterized protein of 109 amino acids. Functional studies suggest its involvement in respiration, specifically as a component of the hydrogen-transporting ATP synthase complex . This association places YLR294C within pathways critical for energy production in yeast cells.
| Protein Characteristics | Details |
|---|---|
| Gene Name | YLR294C |
| Protein Length | 109 AA |
| Function | Respiration |
| Sequence | MMLRKPKKVIELFIASSLSKKKQTEPQAEQDHYFWLSSSHLFIFESSTIKKKQNTLRTLCNQPHKMQNLFFKQKIQLYIDTSLSFLLLLFFYFNNYYFLSMTYASLVNK |
The YLR294C antibody is available as monoclonal antibodies targeting synthetic peptides in the N-terminal, C-terminal, and middle regions of the protein.
Epitope mapping services are available for these antibodies at $100 per combination, enabling researchers to identify specific binding sites .
The YLR294C antibody is primarily used in:
Western blotting (WB): Detects 1 ng of recombinant protein .
Immunoblotting: Applied in studies of yeast stress responses (e.g., oxidative stress pathways) .
Abmart: Anti-YLR294C (yeast) antibodies.
PMC: Mtl1 Is Required to Activate General Stress Response through Tor1.
Cusabio: Customize YLR294C Antibody.
STRING: 4932.YLR294C
YLR294C is a yeast gene encoding a protein that serves as an important target for immunological research. Antibodies against this protein enable researchers to investigate protein expression, localization, and function in various experimental conditions. While specific commercial antibodies may exist, academic researchers often need custom antibodies for specialized applications. Developing effective antibody-based detection methods requires understanding both the target protein characteristics and appropriate antibody selection criteria.
Both polyclonal and monoclonal antibodies can be generated against YLR294C. Polyclonal antibodies comprise diverse antibody populations that recognize multiple epitopes on the target protein. In contrast, monoclonal antibodies are identical copies of an antibody that bind to a single epitope with high specificity . For YLR294C research, choosing between these antibody types depends on the specific experimental requirements. Monoclonal antibodies offer consistent reproducibility across experiments, while polyclonal antibodies may provide higher sensitivity due to their ability to bind multiple epitopes simultaneously.
Validating antibody specificity is critical for ensuring experimental reliability. For YLR294C antibodies, multiple validation approaches are recommended:
Western blotting against both wild-type samples and YLR294C knockout/mutant controls
Immunoprecipitation followed by mass spectrometry to confirm target binding
Immunofluorescence with appropriate controls to verify subcellular localization patterns
Pre-absorption tests using purified YLR294C protein to confirm specificity
Cross-reactivity testing against closely related proteins
These validation steps help confirm that observed signals truly represent YLR294C protein rather than non-specific interactions.
Cryo-electron microscopy (cryoEM) provides a powerful approach for characterizing antibody-antigen interactions at near-atomic resolution. For YLR294C antibodies, cryoEM can reveal precise epitope-paratope interfaces, enabling researchers to understand the structural basis of antibody binding . This method involves:
Complex formation between YLR294C protein and antibody fragments (Fabs)
Vitrification of samples for cryoEM analysis
Image acquisition and processing to generate 3D reconstructions
Model building and refinement to map the binding interface
By combining cryoEM with next-generation sequencing of immune repertoires, researchers can identify specific complementarity-determining regions (CDRs) involved in YLR294C recognition, facilitating antibody engineering for improved specificity or affinity .
When YLR294C antibodies are initially generated in non-human systems (e.g., chicken, rabbit), humanization may be necessary for certain applications. An efficient humanization approach utilizes yeast surface display (YSD) combined with fluorescence-activated cell sorting (FACS) . The process involves:
CDR grafting - transferring the complementarity-determining regions from the non-human antibody to a human antibody framework
Display of humanized antibody variants on yeast cell surfaces
Selection of functional variants via FACS based on YLR294C binding
Next-generation sequencing to identify optimal humanized candidates
Validation of selected variants for maintained affinity and improved properties
This methodology provides a systematic approach to developing humanized YLR294C antibodies while preserving critical binding properties .
For challenging antigens like membrane-associated proteins, computational design approaches can significantly enhance antigen preparation. Similar to strategies used for CD20, researchers can:
Identify the key epitope regions of YLR294C
Design soluble protein scaffolds that present these epitopes in native-like conformations
Express and purify the engineered antigens
Validate proper folding and epitope presentation using existing antibodies
This computational approach enables the creation of water-soluble YLR294C mimics that maintain critical epitopes while eliminating the challenges associated with membrane protein purification . Such designed antigens can be used for antibody discovery platforms including yeast display, phage display, or animal immunization.
Successful immunoprecipitation (IP) with YLR294C antibodies requires careful optimization:
Cell lysis buffer selection: Use buffers containing mild detergents (0.5-1% NP-40 or Triton X-100) to solubilize YLR294C while preserving native protein conformation
Antibody concentration: Typically 2-5 μg antibody per 500 μg-1 mg of total protein extract
Incubation conditions: 4°C overnight with gentle rotation to maximize binding while minimizing non-specific interactions
Washing stringency: Balance between removing non-specific binding (higher stringency) and maintaining specific interactions (lower stringency)
Elution methods: Choose between denaturing (SDS, boiling) or non-denaturing (competing peptides) based on downstream applications
For challenging IPs, pre-clearing lysates with protein A/G beads and including appropriate blocking agents (BSA, non-immune IgG) can reduce background.
Robust experimental controls are essential for interpreting results with YLR294C antibodies:
| Control Type | Implementation | Purpose |
|---|---|---|
| Negative genetic control | YLR294C knockout/deletion strain | Confirms signal specificity |
| Isotype control | Non-specific antibody of same isotype | Assesses non-specific binding |
| Blocking peptide control | Pre-incubation with immunizing peptide | Verifies epitope specificity |
| Expression control | Cells with manipulated YLR294C expression | Validates signal correlation with expression |
| Secondary antibody only | Omit primary antibody | Detects secondary antibody background |
These controls should be processed identically to experimental samples and included in each experiment to ensure reliable interpretation of results.
Cross-reactivity can compromise experimental results. When YLR294C antibodies show cross-reactivity, consider these approaches:
Epitope mapping to identify unique regions for more specific antibody generation
Affinity purification against the specific YLR294C epitope
Pre-absorption with related proteins to remove cross-reactive antibodies
Validation in multiple assay formats to confirm specificity
Computational analysis to identify potentially cross-reactive epitopes before antibody generation
For monoclonal antibodies showing cross-reactivity, alternative clones recognizing different epitopes can be evaluated. For polyclonal antibodies, affinity purification against the specific target often improves specificity.
Detecting low-abundance YLR294C requires sensitivity enhancement strategies:
Signal amplification methods:
Tyramide signal amplification for immunohistochemistry/immunofluorescence
Enhanced chemiluminescence substrates for Western blotting
Biotin-streptavidin amplification systems
Sample preparation refinements:
Subcellular fractionation to concentrate YLR294C-containing compartments
Immunoprecipitation before Western blotting (IP-Western)
Optimized extraction buffers to maximize YLR294C solubilization
Detection system optimization:
More sensitive detection instruments (e.g., cooled CCD cameras)
Longer exposure times balanced against background increase
Signal integration over multiple time points
These approaches can be combined as needed to achieve the required sensitivity threshold.
Antibodies provide powerful tools for mapping protein interaction networks. For YLR294C, consider:
Co-immunoprecipitation (Co-IP) followed by:
Western blotting for known/suspected partners
Mass spectrometry for unbiased interaction discovery
Sequential IPs (tandem IP) for complex purification
Proximity-dependent labeling approaches:
BioID fusion to YLR294C with antibody-based detection
APEX2 proximity labeling with anti-YLR294C verification
Fluorescence-based interaction studies:
FRET between labeled antibodies or antibody fragments
Proximity ligation assay (PLA) using YLR294C antibody paired with antibodies against potential partners
These complementary approaches provide multiple lines of evidence for protein interactions, strengthening confidence in identified partners.
Using antibodies against multiple distinct YLR294C epitopes offers several advantages:
Confirmation of signal specificity through co-localization of independent antibody signals
Increased detection sensitivity, particularly for conformationally diverse or processed forms
Mitigation of epitope masking due to protein-protein interactions or post-translational modifications
Creating antibody pairs for sandwich immunoassays (ELISA, immunohistochemistry)
When developing multiple antibodies, target epitopes in different protein domains to maximize complementarity. Computational structure prediction can help identify accessible epitopes and avoid regions prone to modification or interaction-based masking.
Next-generation sequencing (NGS) technologies significantly advance antibody development workflows:
Immune repertoire sequencing to identify antibody families responding to YLR294C immunization
Paired heavy-light chain sequencing to discover complete antibody sequences
Integration with structural data for refined antibody candidate selection
Monitoring clonal evolution during immunization to optimize timing of B-cell harvesting
Rapid identification of antibody sequences from polyclonal sera through structure-guided bioinformatic approaches
This integration of NGS with structural biology creates a powerful platform for antibody discovery without requiring extensive single B-cell sorting or screening campaigns .
Computational design represents a frontier in antibody engineering that could be applied to YLR294C research:
In silico epitope prediction to identify optimal YLR294C target sites
Framework optimization to enhance stability while maintaining binding properties
CDR refinement to improve affinity and specificity
Developability assessment to predict and mitigate potential manufacturing issues
Multispecific antibody design to simultaneously target YLR294C and other relevant proteins
These computational approaches complement experimental methods, potentially reducing development timelines and enhancing antibody performance characteristics.
Single-cell methodologies offer unprecedented resolution for antibody discovery:
Single B-cell sorting based on YLR294C binding, enabling direct isolation of antigen-specific cells
Single-cell RNA sequencing to capture paired heavy and light chain sequences from individual B cells
Microfluidic antibody screening platforms for rapid functional assessment
Linking genotype (antibody sequence) with phenotype (binding properties) at single-cell resolution
Discovery of rare antibody clones that might be missed in bulk analysis
These technologies enable more efficient identification of high-quality YLR294C antibodies while providing deeper insights into immune responses to this antigen.