YOL013W-A Antibody

Target Protein: YOL013W-A

YOL013W-A is a 63-amino acid protein encoded by the dubious ORF YOL013W-A in S. cerevisiae. Key features include:

• Sequence:
  $\text{MMCIINSESFHGSQKRSGVWSSGMILALGDFLINRGTKHARGPGFNSQLAPFFTIEKYSVRRS}$ .

• Genomic Context: Overlaps with tRNA genes such as tP(UGG)O1, suggesting proximity to RNAPIII-transcribed regions .

• Functional Association: Co-localizes with Cdk1, a kinase regulating cell cycle-dependent tRNA synthesis .

Antibody Characteristics

Commercial YOL013W-A antibodies are available in monoclonal (mAb) and polyclonal formats, targeting specific epitopes:

Key Features:

• Epitope Specificity:

  • Abmart offers three mAb combinations targeting N-terminal, C-terminal, or mid-region synthetic peptides .

  • Cusabio’s polyclonal antibody detects the full-length protein .

• Validation:

  • Phos-tag gel and co-immunoprecipitation (co-IP) validated in studies linking Cdk1 to tRNA synthesis .

Research Applications

YOL013W-A antibodies are used to investigate:

• RNAPIII Transcription: Cdk1 recruitment to tDNA genes enhances TFIIIB-TFIIIC interactions, which these antibodies help visualize via ChIP-qPCR or co-IP .

• Cell Cycle Regulation: Synchronized yeast cells are lysed (50 mM HEPES-KOH, 1% Triton X-100) for immunoprecipitation studies to analyze phosphorylation-dependent protein interactions .

Example Protocol (Co-IP):

1. Cell Lysis: Use ice-cold TBS buffer with protease/phosphatase inhibitors .

2. Antibody Binding: Incubate lysate with YOL013W-A antibodies conjugated to magnetic beads .

3. Analysis: Resolve proteins via SDS-PAGE and detect using Western blotting .

Purchase Options (Abmart3):

Notes:

• AbInsure™: The X2-P0C272 package includes warranty for WB applications .

• Custom Development: Suppliers offer epitope-specific mAbs for functional studies (e.g., blocking assays) .