Uncharacterized 6.6 kDa Antibody

What is the Uncharacterized 6.6 kDa Antibody and its target protein?

The Uncharacterized 6.6 kDa Antibody is a polyclonal antibody raised in rabbits against a recombinant Escherichia coli Uncharacterized 6.6 kDa protein. This antibody specifically recognizes a low molecular weight bacterial protein with UniProt accession number P18352 . The target protein has the amino acid sequence MQSLAQFKSSGLWVTTHAWLNDRFLLPESQQKNLAELKRSFLDPALKRINEKTPLLA and is primarily studied in bacterial systems .

What are the structural characteristics of the 6.6 kDa protein?

The 6.6 kDa protein is a small bacterial protein that has been identified in various bacterial species. In Borrelia burgdorferi (the Lyme disease causative agent), the 6.6 kDa protein is a lipoprotein designated as lp6.6, with a predicted molecular mass of approximately 6,600 Da when accounting for conventional processing and acylation. The mature protein consists of 51 amino acids preceded by a 17-amino-acid putative signal peptide terminated by LFVAC, a probable consensus sequence for lipoprotein modification .

What are the validated applications for this antibody?

The Uncharacterized 6.6 kDa Antibody has been validated for:

• Enzyme-Linked Immunosorbent Assay (ELISA)

• Western Blot (WB) for identification of the target antigen

Storage recommendations include maintaining the antibody at -20°C or -80°C, avoiding repeated freeze-thaw cycles. The antibody is typically supplied in a preservative buffer containing 0.03% Proclin 300, 50% Glycerol, and 0.01M PBS at pH 7.4 .

How should researchers optimize Western blot protocols when using the Uncharacterized 6.6 kDa Antibody?

When performing Western blots with the Uncharacterized 6.6 kDa Antibody, researchers should consider the following optimization steps:

• Sample preparation: Due to the small size of the target protein (6.6 kDa), use high-percentage polyacrylamide gels (15-20%) to adequately resolve low molecular weight proteins.

• Transfer conditions: Employ a semi-dry transfer system with methanol-containing buffer to enhance transfer efficiency of small proteins.

• Blocking optimization: Use 5% non-fat dry milk or BSA in TBS-T for blocking.

• Antibody dilution: Start with a 1:1000 dilution of the primary antibody and adjust based on signal strength.

• Detection system selection: For low abundance targets, consider using high-sensitivity chemiluminescent substrates or fluorescent secondary antibodies.

• Controls: Include recombinant 6.6 kDa protein as a positive control to validate antibody specificity .

Based on experimental data with similar small bacterial proteins, researchers should be aware that the electrophoretic mobility of the native 6.6 kDa protein may differ slightly from recombinant versions due to post-translational modifications, particularly lipidation .

What are the key considerations for epitope mapping studies using this antibody?

For epitope mapping studies with the Uncharacterized 6.6 kDa Antibody, researchers should consider employing advanced techniques such as DECODE (Decoding Epitope Composition by Optimized-mRNA-display, Data analysis, and Expression sequencing), which allows for high-throughput and precise epitope analysis at single amino acid resolution .

The DECODE method enables:

• Identification of patterns of epitopes recognized by antibodies at single amino acid resolution

• Prediction of cross-reactivity against entire protein databases

• Quantification of variations in recognition by antibodies

When performing epitope mapping:

• Generate a random peptide library displayed on mRNA

• Perform selection against the immobilized Uncharacterized 6.6 kDa Antibody

• Use next-generation sequencing to analyze selected peptides

• Calculate similarity scores (such as DECODE scores) to identify epitope hotspots

• Validate identified epitopes using mutagenesis and competitive ELISA assays

How does the Uncharacterized 6.6 kDa Antibody compare to other antibodies targeting small bacterial proteins?

The Uncharacterized 6.6 kDa Antibody shows similar properties to other antibodies targeting small bacterial proteins but differs in several respects:

• Size specificity: Unlike many commercial antibodies that often recognize larger proteins, this antibody is specifically raised against an unusually small protein target (6.6 kDa), making it somewhat specialized for detection of low molecular weight bacterial components.

• Cross-reactivity profile: The antibody is primarily reactive with Escherichia coli targets, with predicted reactivity to bacterial species only . This contrasts with antibodies like monoclonal antibody 240.7, which recognizes a conserved low molecular weight lipoprotein across multiple Borrelia species .

• Detection sensitivity: Similar to other bacterial protein antibodies, detection may require optimization of extraction methods, particularly for membrane-associated small proteins that might require specialized extraction buffers .

• Phase-specific expression: Research on similar small bacterial proteins suggests that some may show differential expression across bacterial life cycles. For example, the Borrelia burgdorferi lp6.6 protein appears to be highly expressed during the arthropod phase but downregulated during mammalian infection .

What methods can be used to assess potential cross-reactivity with human proteins?

To assess potential cross-reactivity of the Uncharacterized 6.6 kDa Antibody with human proteins, researchers can employ a systematic approach:

• In silico analysis:

  • Perform BLAST searches of the immunogen sequence against human proteome databases

  • Calculate DECODE scores for all human proteins to identify potential cross-reactive epitopes

  • Analyze sequence similarity focusing particularly on the epitope regions

• Experimental validation:

  • Western blot analysis using human cell lysates from multiple tissue types

  • Immunoprecipitation followed by mass spectrometry to identify any pulled-down human proteins

  • Competitive ELISA using human protein lysates to assess displacement of antibody binding

• Negative controls:

  • Include pre-immune serum controls to distinguish specific from non-specific binding

  • Use knockout or knockdown systems where the target protein is absent

• Validation across methods:

  • Compare results across different immunological techniques (WB, ELISA, IHC)

  • Employ epitope mapping to confirm binding specificity

How can the Uncharacterized 6.6 kDa Antibody be utilized in studies of bacterial protein localization?

The Uncharacterized 6.6 kDa Antibody can be valuable for bacterial protein localization studies using these advanced approaches:

• Subcellular fractionation coupled with immunoblotting:

  • Separate bacterial cellular components (membrane, cytoplasm, periplasm)

  • Perform Western blot analysis on each fraction

  • Quantify relative distribution across compartments

  This approach revealed that the similarly sized lp6.6 protein in B. burgdorferi was associated with the outer membrane fraction despite not being surface-exposed .

• Immunoelectron microscopy:

  • Fix bacterial cells with minimal cross-linking

  • Section and immunolabel with the Uncharacterized 6.6 kDa Antibody

  • Use gold-conjugated secondary antibodies for visualization

  • Analyze distribution patterns at ultrastructural level

• Phase separation analysis:

  • Employ Triton X-114 phase partitioning to separate hydrophobic from hydrophilic proteins

  • Analyze the distribution of the target protein between detergent and aqueous phases

  • This method can reveal lipid modifications, as demonstrated with similar small bacterial lipoproteins

• Immunofluorescence microscopy optimization:

  • Use specialized fixation methods optimized for small bacterial proteins

  • Apply membrane permeabilization protocols judiciously

  • Employ super-resolution microscopy techniques for more precise localization

  • Include appropriate controls using known localization markers

What are the methodological approaches for studying post-translational modifications of the 6.6 kDa protein using this antibody?

To investigate post-translational modifications (PTMs) of the 6.6 kDa protein using this antibody, researchers can employ these methodological approaches:

• Mass spectrometry-based approaches:

  • Immunoprecipitate the protein using the Uncharacterized 6.6 kDa Antibody

  • Perform LC-MS/MS analysis on the precipitated protein

  • Search for PTM signatures such as lipidation, phosphorylation, or glycosylation

  • Compare spectra with predicted modifications based on sequence motifs

• Selective extraction protocols:

  • For lipidation analysis: Use Triton X-114 phase partitioning to separate lipidated from non-lipidated forms

  • For phosphorylation: Use phosphatase treatments followed by mobility shift analysis

  • For glycosylation: Use glycosidase treatments to assess mobility shifts

• Site-directed mutagenesis validation:

  • Generate recombinant versions with mutations at predicted PTM sites

  • Compare antibody recognition between wild-type and mutant forms

  • Assess functional consequences of PTM loss

• Specific PTM detection:

  • For bacterial lipoproteins: Use radiolabeled palmitate incorporation assays

  • For phosphorylation: Employ phospho-specific staining methods

  • For glycosylation: Use lectin blotting in parallel with antibody detection

Similar approaches revealed that the lp6.6 protein in B. burgdorferi undergoes lipid modification, resulting in a mature lipid-modified molecule with approximately 6.6 kDa molecular mass .

What are common technical challenges when working with antibodies against very small proteins?

Researchers face several technical challenges when working with antibodies against very small proteins like the 6.6 kDa target:

• Gel resolution limitations:

  • Small proteins run at the gel front in standard SDS-PAGE

  • Solution: Use high percentage (15-20%) gels or specialized tricine-SDS-PAGE systems designed for low molecular weight proteins

  • Consider gradient gels (10-20%) for simultaneous resolution of markers and small targets

• Transfer inefficiency:

  • Small proteins may pass through membrane pores during electrotransfer

  • Solution: Use PVDF membranes with smaller pore sizes (0.2 μm)

  • Consider semi-dry transfer systems with optimized buffers containing 20% methanol

  • Use lower transfer voltages for longer durations

• Epitope accessibility issues:

  • Small proteins may have limited epitopes available for antibody binding

  • Solution: Use multiple antibody clones or polyclonal preparations targeting different regions

  • Consider native versus denaturing conditions for epitope exposure

• Signal detection challenges:

  • Low abundance of small proteins can lead to weak signals

  • Solution: Employ signal amplification methods such as tyramide signal amplification

  • Use high-sensitivity detection systems with longer exposure times

  • Consider sample enrichment through immunoprecipitation prior to analysis

• Specificity verification:

  • Difficult to distinguish specific bands from non-specific binding near gel front

  • Solution: Include appropriate controls (recombinant protein, pre-immune serum)

  • Perform peptide competition assays to confirm specificity

How can researchers validate the specificity of the Uncharacterized 6.6 kDa Antibody in complex samples?

To validate the specificity of the Uncharacterized 6.6 kDa Antibody in complex samples, researchers should implement a multi-faceted approach:

• Expression systems validation:

  • Express the target protein in an E. coli system lacking the endogenous gene

  • Create a GST-fusion construct for expression and purification of the recombinant protein

  • Compare antibody recognition between wild-type and recombinant systems

  • This approach successfully validated similar small protein antibodies as shown in the literature

• Competitive binding assays:

  • Pre-incubate the antibody with purified recombinant 6.6 kDa protein

  • Compare binding patterns in Western blots with and without competition

  • Observe signal reduction in the presence of the competing antigen

• Genetic knockout/knockdown verification:

  • Generate knockout strains lacking the target protein gene

  • Compare antibody binding between wild-type and knockout samples

  • Absence of signal in knockout samples confirms specificity

• Multi-method cross-validation:

  • Compare detection patterns across different immunological techniques (WB, ELISA, IHC)

  • Consistent results across methods increase confidence in specificity

• Mass spectrometry-based validation:

  • Immunoprecipitate proteins using the antibody

  • Analyze precipitated components by mass spectrometry

  • Confirm the presence of the target protein in the precipitated material

  • Evaluate co-precipitating proteins for potential cross-reactivity

• Epitope mapping:

  • Use DECODE or similar epitope mapping methods to precisely define the epitope

  • Compare the mapped epitope to protein databases to identify potential cross-reactive proteins

How might the Uncharacterized 6.6 kDa Antibody be utilized in studies of bacterial pathogenesis or host-pathogen interactions?

The Uncharacterized 6.6 kDa Antibody could contribute to bacterial pathogenesis research through several innovative approaches:

• Expression profile analysis during infection:

  • Track expression levels of the 6.6 kDa protein during different infection phases

  • Compare expression in various infection models (in vitro, ex vivo, in vivo)

  • Determine if expression is regulated by host-derived signals

  Research on similar small proteins suggests potential phase-specific expression patterns, such as the lp6.6 protein in B. burgdorferi which appears to be associated with the arthropod phase of the bacterial life cycle .

• Functional characterization via neutralization studies:

  • Test whether antibody binding affects bacterial growth or virulence

  • Develop in vitro growth inhibition assays using the antibody

  • Evaluate changes in bacterial phenotype following antibody treatment

  Studies with similar sized bacterial proteins utilized growth inhibition assays to assess the functional significance of antibody binding .

• Host response monitoring:

  • Assess whether hosts naturally develop antibodies against the 6.6 kDa protein during infection

  • Compare immune responses to this protein across different infection stages

  • Evaluate potential as a diagnostic biomarker

• Structure-function relationships:

  • Use the antibody to perform pull-down assays identifying interaction partners

  • Map functional domains by comparing antibody binding with functional assays

  • Assess roles in bacteria-host protein interactions

• Therapeutic potential assessment:

  • Evaluate passive immunization potential in appropriate models

  • Test antibody-antibiotic combination therapies

  • Assess as a potential vaccine component

What approaches could be used to integrate this antibody into high-throughput screening or diagnostic applications?

Researchers can integrate the Uncharacterized 6.6 kDa Antibody into high-throughput screening or diagnostic applications through these methodological approaches:

• Development of ELISA-based diagnostic assays:

  • Optimize antibody concentration and blocking conditions

  • Establish sensitivity and specificity parameters using known positive and negative samples

  • Develop sandwich ELISA formats using complementary antibodies

  • Evaluate performance across diverse sample types (blood, urine, tissue)

• Antibody arrays and multiplexed detection systems:

  • Immobilize the antibody onto microarray platforms alongside other bacterial protein antibodies

  • Develop fluorescence-based detection systems for multiplexed analysis

  • Create pattern recognition algorithms for species identification based on protein expression profiles

  • Integrate into point-of-care diagnostic devices

• Biosensor development:

  • Couple the antibody to various biosensing platforms (SPR, electrochemical, piezoelectric)

  • Optimize binding and washing conditions for high sensitivity and specificity

  • Validate with clinical or environmental samples

  • Develop automated sample processing and reading systems

• Integration with DECODE for epitope mapping applications:

  • Utilize the high-throughput DECODE system for comprehensive epitope mapping

  • Apply to serum samples to identify disease-specific epitopes

  • Develop diagnostic tools based on epitope signature patterns

  • This approach has shown promise for identifying pathogenic epitopes from antibodies in blood without prior antigen information

• Automated image analysis systems:

  • Develop standard protocols for immunofluorescence or immunohistochemistry

  • Create computer vision algorithms for automated detection and quantification

  • Implement in bacterial identification systems for clinical microbiology

  • Validate against gold standard methods

The implementation of such approaches would require careful validation against established diagnostic methods and comprehensive evaluation of sensitivity, specificity, and reproducibility across diverse sample types.

How should researchers interpret unexpected molecular weight variations when detecting the 6.6 kDa protein?

When encountering unexpected molecular weight variations while detecting the 6.6 kDa protein, researchers should consider the following interpretive framework:

• Post-translational modifications impact:

  • Lipidation can increase apparent molecular weight by approximately 0.8-1.0 kDa

  • Phosphorylation adds approximately 80 Da per phosphate group

  • Glycosylation can substantially increase molecular weight and cause band smearing

  Research on similar bacterial lipoproteins showed that lipid modification of the lp6.6 protein in B. burgdorferi resulted in a mature lipid-modified molecule with approximately 6.6 kDa molecular mass, whereas the non-lipidated core protein would have a molecular weight of only 5.8 kDa .

• Oligomerization assessment:

  • Analyze samples under reducing and non-reducing conditions

  • Compare heat-treated versus non-heated samples

  • Use chemical crosslinking to stabilize potential oligomers

  • Small proteins may form dimers or higher-order structures affecting migration

• Technical factors evaluation:

  • Buffer composition affects SDS binding and migration

  • Gel percentage significantly impacts migration of small proteins

  • Transfer efficiency varies with protocol and can distort apparent size

  • Standard markers may be unreliable below 10 kDa

• Proteolytic processing consideration:

  • N-terminal signal peptide cleavage (17 amino acids in lp6.6)

  • C-terminal processing or degradation

  • Sample-specific protease activity

  • Compare with recombinant standards of known sequence

• Methodological validation:

  • Confirm identity via mass spectrometry

  • Sequence N-terminus of purified protein

  • Compare migration in alternative gel systems (Tricine-SDS-PAGE)

  • Use antibodies targeting different epitopes to confirm identity

When interpreting results, researchers should note that the recombinant non-lipidated 6.6 kDa protein may migrate slightly slower than its native counterpart in SDS-PAGE due to differential SDS binding, as observed with similar bacterial proteins .

What statistical approaches are recommended for analyzing epitope mapping data generated using this antibody?

For analyzing epitope mapping data generated with the Uncharacterized 6.6 kDa Antibody, researchers should consider these statistical and computational approaches:

• Enrichment analysis for converged peptides:

  • Calculate fold enrichment of each peptide sequence compared to input library

  • Apply Fisher's exact test to determine statistical significance of enrichment

  • Establish appropriate false discovery rate thresholds (typically q < 0.05)

  • Plot enrichment distribution to identify outliers representing strong binders

• Sequence motif identification:

  • Apply position-specific scoring matrices to identify conserved motifs

  • Utilize multiple sequence alignment algorithms

  • Employ machine learning approaches such as hidden Markov models

  • Calculate information content at each position to identify critical residues

• DECODE score calculation and analysis:

  • Calculate protein-wide DECODE scores using amino acid similarity matrices (BLOSUM62 or WAC table)

  • Set appropriate threshold values based on distribution analysis

  • Compare scores across the proteome to identify potential cross-reactive targets

  • Validate top hits experimentally

• Mutational analysis statistical processing:

  • Perform alanine scanning or similar mutational approaches

  • Calculate ΔΔG values for each mutation to quantify contribution to binding

  • Apply hierarchical clustering to group mutations with similar effects

  • Correlate with structural information when available

• Multivariate analysis for complex epitope landscapes:

  • Apply principal component analysis to reduce dimensionality

  • Use hierarchical clustering to identify related epitope groups

  • Implement machine learning algorithms for pattern recognition

  • Visualize epitope landscapes using heat maps or 3D projections

• Validation through cross-correlation:

  • Calculate correlation coefficients between epitope mapping data and functional assays

  • Assess concordance between computational predictions and experimental results

  • Implement bootstrap resampling to estimate confidence intervals

  • Perform sensitivity analysis to identify robust versus variable epitope features

The DECODE method has demonstrated the ability to provide high-quality epitope information with single amino acid resolution, using these statistical approaches to successfully identify epitopes recognized by monoclonal and polyclonal antibodies .