ZBP14 Antibody

What is ZBTB14 and what are its main biological functions?

ZBTB14 (also known as ZF5, ZFP161, or zinc finger protein 161) is a transcription factor with multiple regulatory roles. It functions as a transcriptional activator of the dopamine transporter (DAT), binding to its promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. Additionally, it binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. ZBTB14 also serves as a transcriptional repressor of MYC and thymidine kinase promoters . Understanding these functions is crucial when designing experiments to investigate ZBTB14's role in specific cellular processes.

What types of ZBTB14 antibodies are commercially available for research?

Several types of ZBTB14 antibodies are available for research applications. These include polyclonal antibodies produced in rabbits, such as those from Invitrogen (catalog number PA562236) and Sigma-Aldrich (product code HPA050758) . Most commercial ZBTB14 antibodies are unconjugated and purified using antigen affinity chromatography methods. These antibodies typically come in buffered aqueous glycerol solutions at concentrations around 0.2 mg/mL . When selecting an antibody, consider the specific experimental applications you intend to use it for, as validation data varies across applications.

What applications can ZBTB14 antibodies be reliably used for?

ZBTB14 antibodies have been validated for multiple research applications. According to product information, they are commonly used for immunohistochemistry (IHC), immunocytochemistry (ICC), immunofluorescence (IF), and Western blot (WB) analyses . When planning experiments, note that recommended dilutions vary by application - for immunofluorescence, a concentration of 0.25-2 μg/mL is typically suggested, while for immunohistochemistry, dilutions of 1:50-1:200 are commonly recommended . Always review the available validation data for your specific application to ensure reliability.

How should I validate a ZBTB14 antibody before using it in my experiments?

The gold standard for antibody validation involves using wild-type cells alongside isogenic CRISPR knockout (KO) controls of the same cell line . This approach provides rigorous validation across multiple applications including Western blot, immunoprecipitation, and immunofluorescence. For ZBTB14 specifically, validation should include:

• Testing the antibody in Western blot using both wild-type and ZBTB14-knockout cell lysates

• Confirming specificity by checking for a single band of the expected molecular weight that disappears in the knockout sample

• For immunofluorescence applications, compare staining patterns between wild-type and knockout cells

• Consider orthogonal validation methods as complementary approaches, but not as replacements for genetic validation methods

Research indicates that while orthogonal strategies may be somewhat suitable for Western blot validation, genetic strategies using knockout controls generate far more robust characterization data, particularly for immunofluorescence applications .

What are the common pitfalls when using ZBTB14 antibodies in research?

Several challenges can affect the reliability of experiments using ZBTB14 antibodies:

• Non-specific binding: Some antibodies may detect unrelated proteins in addition to ZBTB14, resulting in non-specific bands in Western blots or background staining in immunofluorescence

• Inconsistent performance across applications: An antibody validated for Western blot may not perform well in immunofluorescence or immunoprecipitation

• Over-reliance on manufacturer recommendations without independent validation: Research shows that 61% of antibodies are recommended by manufacturers based on orthogonal approaches, but these may not be as reliable as genetic validation approaches

• Inadequate controls: Failing to include proper positive and negative controls in experiments

To mitigate these issues, always conduct application-specific validation and include appropriate controls in every experiment. The literature suggests that approximately 20-30% of figures in scientific publications may be generated using antibodies that do not specifically recognize their intended targets .

How can I optimize immunoprecipitation (IP) experiments using ZBTB14 antibodies?

Optimizing immunoprecipitation with ZBTB14 antibodies requires careful consideration of several parameters:

• Antibody selection: Not all ZBTB14 antibodies are suitable for IP. Interestingly, research indicates that 37% of antibodies not specifically recommended for IP by manufacturers were actually able to enrich their cognate antigen . Consider testing multiple antibodies if available.

• Lysis conditions: ZBTB14 is a nuclear protein, so use nuclear extraction protocols with appropriate buffers containing:

  • DNase treatment to release DNA-bound protein

  • Protease inhibitors to prevent degradation

  • Appropriate salt concentrations to maintain protein-protein interactions

• Cross-linking considerations: For chromatin immunoprecipitation (ChIP) applications, optimize formaldehyde cross-linking time to capture ZBTB14 interactions with DNA.

• Controls: Always include:

  • Input control (pre-IP sample)

  • Negative control (non-specific IgG from the same species as your antibody)

  • If possible, a ZBTB14 knockout sample as a specificity control

• Validation: Confirm successful IP by Western blot using a different ZBTB14 antibody or an antibody recognizing a different epitope.

What are the best strategies for multiplexing ZBTB14 antibodies with other markers in immunofluorescence?

When designing multiplexed immunofluorescence experiments with ZBTB14 antibodies:

• Antibody compatibility: Select antibodies raised in different host species to avoid cross-reactivity of secondary antibodies. For example, if using a rabbit polyclonal ZBTB14 antibody, pair it with mouse or goat antibodies against other targets.

• Epitope retrieval optimization: Different antibodies may require different antigen retrieval methods. Test and optimize a protocol that works for all antibodies in your panel.

• Signal amplification considerations: For low-abundance targets, consider using amplification systems like tyramide signal amplification (TSA) for the weakest signals.

• Staining sequence: If using multiple rabbit antibodies with sequential staining:

  • Complete the first staining including secondary antibody

  • Apply a blocking step with excess unconjugated Fab fragments

  • Proceed with the next primary antibody

• Spectral separation: Ensure fluorophores have minimal spectral overlap, or implement spectral unmixing during image acquisition/analysis.

• Controls: Include single-stained controls for each antibody to verify specificity and absence of bleed-through.

How reliable are ZBTB14 antibodies for quantitative analyses in research applications?

The reliability of ZBTB14 antibodies for quantitative analyses depends on several factors:

• Antibody validation rigor: Quantitative applications require highly specific antibodies. Recent large-scale validation studies found that of 614 commercially available antibodies tested against 65 proteins, approximately two-thirds of proteins were covered by at least one high-performing antibody, and half were covered by at least one high-performing renewable antibody . This suggests reasonable but not universal reliability.

• Linear dynamic range: For quantitative Western blot or ELISA, verify that:

  • Signal intensity correlates linearly with protein concentration over the expected range

  • The antibody doesn't saturate at higher protein concentrations

  • Background signal is consistently low across experiments

• Reproducibility: Test batch-to-batch consistency, especially for polyclonal antibodies which may show greater variability than monoclonals or recombinant antibodies.

• Normalization strategies: For Western blots, normalize to appropriate loading controls and consider using fluorescent secondary antibodies for more accurate quantification.

• Standards: Include calibration standards of known ZBTB14 concentration when possible.

Data from large-scale antibody validation projects suggest that genetic validation strategies (using knockout controls) provide more reliable antibodies for quantitative applications compared to orthogonal validation approaches .

What are the most common causes of inconsistent results when using ZBTB14 antibodies?

Inconsistent results with ZBTB14 antibodies may stem from several causes:

• Antibody quality and specificity issues: Research indicates that approximately 20-30% of figures in scientific literature may be generated using antibodies that do not specifically recognize their intended targets . Validate your antibody using genetic approaches (KO controls) when possible.

• Technical variations:

  • Sample preparation inconsistencies (lysis buffers, protein extraction methods)

  • Storage conditions affecting antibody stability (repeated freeze-thaw cycles)

  • Incubation time and temperature variations

  • Blocking reagent efficiency

• Biological variables:

  • Cell type differences in ZBTB14 expression levels

  • Post-translational modifications affecting epitope recognition

  • Splice variant expression

  • Protein-protein interactions masking epitopes

• Protocol deviations:

  • Inconsistent transfer efficiency in Western blots

  • Variations in fixation protocols for immunofluorescence

  • Changes in secondary antibody batches or detection systems

To address these issues, standardize protocols rigorously, maintain detailed records of reagents and conditions, and include appropriate controls in each experiment.

How should I interpret contradictory data between different ZBTB14 antibodies?

When faced with contradictory results between different ZBTB14 antibodies:

• Evaluate antibody validation quality: Prioritize data from antibodies validated using genetic approaches (knockout controls) over those validated using orthogonal approaches. Research shows that for immunofluorescence applications, 80% of antibodies validated using genetic strategies were confirmed, compared to only 38% of those validated using orthogonal strategies .

• Consider epitope differences:

  • Different antibodies may recognize different regions of ZBTB14

  • Some epitopes may be masked by protein-protein interactions or post-translational modifications

  • The immunogen sequence used for ZBTB14 antibodies often includes: "LRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSP"

• Implement orthogonal techniques:

  • Complement antibody-based methods with non-antibody techniques (e.g., mass spectrometry)

  • Use genetic approaches (siRNA knockdown, CRISPR knockout) to validate findings

  • Consider mRNA expression analysis to corroborate protein-level data

• Consult the literature systematically:

  • Review how specific antibodies have performed in published studies

  • Contact authors of relevant publications for technical advice

  • Check antibody validation databases and repositories

• Document and report discrepancies transparently in publications to contribute to improved research reproducibility.

What controls should I include when using ZBTB14 antibodies in various experimental systems?

Proper experimental controls are essential for reliable results with ZBTB14 antibodies:

• For all applications:

  • Positive control: Cell line or tissue with known ZBTB14 expression

  • Negative control: ZBTB14 knockout or knockdown sample (gold standard)

  • Secondary antibody only control: To assess non-specific binding of secondary antibody

• For Western blot:

  • Loading control: Housekeeping protein (e.g., GAPDH, β-actin) to normalize protein loading

  • Molecular weight marker: To confirm band size matches expected ZBTB14 molecular weight

  • Peptide competition: Pre-incubation of antibody with immunizing peptide should abolish specific signal

• For Immunofluorescence/Immunohistochemistry:

  • Isotype control: Non-specific IgG from same species as primary antibody

  • Autofluorescence control: Sample without any antibodies to assess tissue autofluorescence

  • Known subcellular localization comparison: ZBTB14 is primarily nuclear, so verify appropriate localization

• For Immunoprecipitation:

  • Input control: Sample before IP to verify target protein presence

  • Non-specific IgG control: To identify non-specific binding

  • Mock IP: Perform IP procedure without antibody

• For ChIP experiments:

  • Input chromatin control: To normalize enrichment

  • IgG control: To establish background signal levels

  • Positive and negative region controls: Genomic regions known to be bound or not bound by ZBTB14

How do I properly document ZBTB14 antibody usage in grant applications and publications?

Proper documentation of ZBTB14 antibody usage enhances reproducibility and transparency:

• In publications:

  • Provide complete antibody information: manufacturer, catalog number, lot number, RRID (Research Resource Identifier)

  • Detail validation methods used to confirm antibody specificity

  • Include dilutions, incubation conditions, and detection methods

  • Describe all controls implemented

  • Present raw, unprocessed images where possible

  • Consider depositing full protocols in repositories like protocols.io

• In grant applications:

  • Justify antibody selection based on validation data

  • Include preliminary data demonstrating antibody specificity for your experimental system

  • Reference relevant publications using the same antibody

  • Address potential pitfalls and alternative approaches

• For NIH training grants and Data Table 4 requirements:

  • Document research funding environment supporting trainee research projects

  • List grants relevant to the proposed application where faculty members are PD/PI or Project/Core Lead

  • For multi-PI awards, divide the total current budget period direct cost evenly between all PIs

  • Calculate average grant support per participating faculty member as a measure of research environment robustness

What resources are available for validating ZBTB14 antibodies across different experimental contexts?

Researchers can access several resources for ZBTB14 antibody validation:

• Public repositories and databases:

  • Human Protein Atlas: Contains extensive validation data for ZBTB14 antibodies in multiple applications

  • Antibody Registry: Assigns unique RRIDs to antibodies for tracking across literature

  • CiteAb: Collates antibody citations from scientific literature to identify well-performing antibodies

  • ZENODO: Houses open access antibody characterization reports from large-scale validation efforts

• Genetic validation resources:

  • CRISPR knockout cell lines for ZBTB14

  • siRNA reagents for knockdown validation

  • Overexpression constructs for specificity testing

• Collaborative initiatives:

  • Antibody validation consortia that implement standardized testing protocols

  • Multi-laboratory validation studies that assess reproducibility across sites

• Manufacturer resources:

  • Technical support from antibody suppliers

  • Detailed protocols optimized for specific applications

  • Access to raw validation data beyond what appears in datasheets

• Research funding support:

  • NIH initiatives supporting antibody validation

  • Specialized shared equipment grants for antibody characterization technologies

How should ZBTB14 antibody data be incorporated into multi-omics research approaches?

Integrating ZBTB14 antibody data with other omics approaches requires careful consideration:

• Correlation with transcriptomics:

  • Compare ZBTB14 protein levels (antibody-based) with mRNA expression data

  • Consider time lags between transcription and translation

  • Investigate discrepancies that might indicate post-transcriptional regulation

• Integration with proteomics:

  • Use mass spectrometry as an orthogonal validation for antibody specificity

  • Combine antibody-based methods with label-free quantification

  • Investigate post-translational modifications that might affect antibody recognition

• Connection with genomics/epigenomics:

  • Link ChIP-seq data (using ZBTB14 antibodies) with RNA-seq to correlate binding with expression changes

  • Integrate with ATAC-seq or DNase-seq to assess chromatin accessibility at ZBTB14 binding sites

  • Use HiChIP or similar approaches to investigate 3D genome interactions mediated by ZBTB14

• Computational integration:

  • Develop data normalization strategies across platforms

  • Apply machine learning approaches to identify patterns across multi-omics datasets

  • Use pathway analysis to contextualize ZBTB14 function within broader biological networks

• Visualization and modeling:

  • Create integrated visualizations combining antibody-based localization with other omics data

  • Develop predictive models of ZBTB14 function based on multi-omics integration

  • Use systems biology approaches to place ZBTB14 within regulatory networks