ZNF23 Antibody

What is ZNF23 and what are its known biological functions?

ZNF23 (also known as Zinc finger protein 23, Zinc finger protein 359, Zinc finger protein 612, or Zinc finger protein KOX16) belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 KRAB domain and 17 C2H2-type zinc fingers . Research has demonstrated that ZNF23 functions as an inhibitor of cell cycle progression, with ectopic expression leading to enhancement of p27(kip-1) expression, growth inhibition, and cell cycle arrest in G1 phase . Notably, the growth-inhibitory effect of ZNF23 was found to be p53-independent, and deletion analysis revealed that this effect relies on its C-terminal zinc fingers rather than the KRAB domain . ZNF23 is believed to be involved in transcriptional regulation and may play a role in embryonic development .

How does ZNF23 regulate cell cycle progression?

ZNF23 inhibits cell cycle progression primarily through enhancing p27(kip-1) expression, which subsequently leads to cell cycle arrest in the G1 phase . Experimental evidence has shown that downregulation of p27(kip-1) using siRNA can reverse the growth inhibition induced by ZNF23, confirming the mechanistic relationship between these proteins . Unlike many other cell cycle regulators, ZNF23's growth-inhibitory effect does not depend on p53 status, suggesting it operates through an alternative pathway for cell cycle control .

What types of ZNF23 antibodies are available for research, and how should I select the appropriate one?

Researchers have several options when selecting ZNF23 antibodies:

• Polyclonal antibodies: These include rabbit polyclonal antibodies against human ZNF23, such as those offered by various suppliers . These antibodies typically recognize a broader range of epitopes and may provide stronger signals in certain applications.

• Monoclonal antibodies: Mouse monoclonal antibodies against ZNF23 are available and offer high specificity and consistency between batches . These are particularly valuable for applications requiring high reproducibility.

Selection criteria should include:

• Intended application (WB, IHC, IF, ELISA)

• Species reactivity (human, mouse, rat)

• Validated epitope region

• Antibody format (unconjugated, conjugated)

• Documentation of validation studies

For quantitative analyses or studies requiring high reproducibility, monoclonal antibodies are preferable, while polyclonal antibodies may be better for detecting low-abundance proteins or when sensitivity is prioritized over specificity .

What epitope regions of ZNF23 are targeted by commonly used antibodies?

Different commercial antibodies target distinct regions of the ZNF23 protein:

• Some antibodies are raised against the immunogen sequence "KSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECG" from ZNF23 .

• Others target recombinant human ZNF23 protein fragments, specifically amino acids 172-436 .

• Certain monoclonal antibodies are produced against synthesized peptides derived from human ZNF23, with the antigen recognition region falling within amino acids 151-200 .

The choice of epitope can affect antibody performance in different applications, with some regions being more accessible in native versus denatured protein conformations. This is an important consideration when selecting antibodies for specific experimental techniques.

How do monoclonal and polyclonal ZNF23 antibodies compare in research applications?

Monoclonal ZNF23 antibodies:

• Provide consistent results between batches and experiments

• Recognize a single epitope, reducing cross-reactivity

• Generally show higher specificity but sometimes lower sensitivity

• Typical working dilutions for applications: 1/500-1/2000 for WB, 1/100-1/300 for IHC, 1/200-1/1000 for IF, and 1/10000 for ELISA

• Particularly valuable for quantitative studies and when comparing results across experiments

Polyclonal ZNF23 antibodies:

• Recognize multiple epitopes, potentially providing stronger signals

• May show batch-to-batch variation

• Often provide higher sensitivity but possibly lower specificity

• Working dilutions for rabbit polyclonal antibodies: 1:1,000-1:2,000 for WB, 1:20,000-1:80,000 for ELISA

• Advantageous for detecting low-abundance proteins or modified forms of the protein

The generation process of monoclonal antibodies, though described for a different protein (ZNF32) in the literature, illustrates the extensive screening and validation typically performed to ensure specificity and sensitivity .

What are the optimal protocols for using ZNF23 antibodies in Western blotting?

Western Blotting Protocol for ZNF23 Detection:

• Sample Preparation:

  • Extract total protein from cells/tissues using standard lysis buffers

  • Quantify protein concentration using Bradford or BCA assay

  • Load 20-50 μg of total protein per well

• Gel Electrophoresis and Transfer:

  • Separate proteins on 10-12% SDS-PAGE

  • Transfer to PVDF or nitrocellulose membrane (0.45 μm)

• Antibody Incubation:

  • Block membrane with 5% non-fat milk or BSA in TBST for 1 hour at room temperature

  • For polyclonal antibodies: Dilute primary antibody 1:1,000-1:2,000 in blocking buffer

  • For monoclonal antibodies: Dilute primary antibody 1:500-1:2,000 in blocking buffer

  • Incubate overnight at 4°C with gentle rocking

  • Wash 3-5 times with TBST

  • Incubate with appropriate HRP-conjugated secondary antibody (1:5,000-1:10,000)

  • Wash 3-5 times with TBST

• Detection:

  • Apply ECL substrate and detect signal using imaging system

  • Expected molecular weight for ZNF23 is approximately 70 kDa

Note: When using antibodies for the first time, it is recommended to test multiple dilutions to determine optimal conditions for your specific sample types.

How should ZNF23 antibodies be applied in immunohistochemistry (IHC) for cancer tissue analysis?

Immunohistochemistry Protocol for ZNF23 in Cancer Tissues:

• Tissue Preparation:

  • Use formalin-fixed, paraffin-embedded (FFPE) tissue sections (4-6 μm thickness)

  • Deparaffinize and rehydrate sections using standard protocols

  • Perform antigen retrieval (citrate buffer pH 6.0 or EDTA buffer pH 9.0)

  • Block endogenous peroxidase with 3% H₂O₂

• Antibody Application:

  • Block non-specific binding with serum-free protein block

  • For anti-ZNF23 polyclonal antibodies: Dilute 1:200-1:500

  • For anti-ZNF23 monoclonal antibodies: Dilute 1:100-1:300

  • Incubate sections with primary antibody overnight at 4°C

  • Wash 3 times with PBS or TBS

  • Apply appropriate HRP-conjugated secondary antibody

  • Develop with DAB substrate

  • Counterstain with hematoxylin, dehydrate, and mount

• Controls and Interpretation:

  • Include positive controls (normal tissues known to express ZNF23)

  • Include negative controls (omitting primary antibody)

  • When analyzing cancer tissues, compare with matched normal tissues

  • ZNF23 typically shows nuclear localization in normal tissues, with reduced or absent staining in cancer tissues

This approach is particularly valuable for studying ZNF23 expression patterns in human pulmonary squamous cell carcinoma and other cancer types, as previous research has shown differential expression between normal and malignant tissues .

What is the optimal protocol for immunofluorescence detection of ZNF23?

Immunofluorescence Protocol for ZNF23 Detection:

• Cell Preparation:

  • Culture cells on coverslips or chamber slides

  • Fix with 4% paraformaldehyde for 15 minutes at room temperature

  • Permeabilize with 0.2% Triton X-100 in PBS for 10 minutes

  • Block with 5% normal serum in PBS for 1 hour

• Antibody Incubation:

  • Dilute anti-ZNF23 monoclonal antibody 1:200-1:1000 in blocking solution

  • For polyclonal antibodies, use at 0.25-2 μg/mL concentration

  • Incubate overnight at 4°C in a humidified chamber

  • Wash 3 times with PBS

  • Incubate with fluorophore-conjugated secondary antibody (1:500-1:1000)

  • Wash 3 times with PBS

  • Counterstain nuclei with DAPI

  • Mount with anti-fade mounting medium

• Visualization and Analysis:

  • Observe using a fluorescence microscope or confocal microscope

  • ZNF23 should be primarily detected in the nucleus

  • Compare expression patterns between different cell types or treatments

  • For co-localization studies, use appropriate markers for subcellular compartments

This method is effective for determining the subcellular localization of ZNF23 and assessing expression levels in different cell types or under various experimental conditions.

What are common issues when using ZNF23 antibodies and how can they be resolved?

Common Problems and Solutions:

• Weak or No Signal in Western Blotting:

  • Potential causes: Low ZNF23 expression, insufficient antigen retrieval, antibody degradation

  • Solutions:

    • Increase protein loading (50-100 μg)

    • Optimize antibody concentration (try higher concentration)

    • Use enhanced chemiluminescence substrate

    • Ensure protein transfer efficiency

    • Check antibody storage conditions (-20°C recommended)

• High Background in Immunohistochemistry:

  • Potential causes: Insufficient blocking, excessive antibody concentration, cross-reactivity

  • Solutions:

    • Increase blocking time/concentration

    • Optimize antibody dilution (try more dilute solutions)

    • Include 0.1-0.3% Triton X-100 in washing steps

    • Use more stringent washing conditions

• Non-specific Bands in Western Blotting:

  • Potential causes: Cross-reactivity, protein degradation, secondary antibody issues

  • Solutions:

    • Add protease inhibitors during sample preparation

    • Optimize blocking conditions (try 5% BSA instead of milk)

    • Increase washing stringency and duration

    • Consider using monoclonal antibodies if using polyclonal

• Variable Results Between Experiments:

  • Potential causes: Batch-to-batch antibody variation, inconsistent protocol

  • Solutions:

    • Use monoclonal antibodies for greater consistency

    • Standardize protocols rigorously

    • Include consistent positive and negative controls

    • Prepare larger batches of working solutions

How should antibodies targeting ZNF23 be stored and handled to maintain their activity?

Optimal Storage and Handling Guidelines:

• Storage Conditions:

  • Store lyophilized antibodies at -20°C upon receipt

  • Once reconstituted, store at -20°C in small aliquots to avoid repeated freeze-thaw cycles

  • Some formulations (e.g., buffered aqueous glycerol solutions) can be stored at -20°C

• Reconstitution:

  • For lyophilized antibodies, reconstitute in the recommended volume of sterile water (typically 200 μl)

  • Mix gently by inversion, avoid vortexing which can denature antibodies

  • Allow complete dissolution before use

• Handling Precautions:

  • Minimize freeze-thaw cycles (no more than 3-5 cycles recommended)

  • Centrifuge briefly before opening vials after thawing

  • When removing an aliquot, keep the antibody on ice

  • Return to storage promptly after use

  • Working solutions can typically be stored at 4°C for up to one week

• Shipping Considerations:

  • Some antibodies are shipped at ambient temperature but must be stored at -20°C immediately upon receipt

  • Others may be shipped with ice packs or dry ice depending on formulation

  • Check manufacturer recommendations for specific products

Following these guidelines will help maintain antibody activity and ensure consistent experimental results over time.

How can I validate the specificity of my ZNF23 antibody?

Antibody Validation Approaches:

• Western Blot Validation:

  • Test on positive control lysates (cells with confirmed ZNF23 expression)

  • Confirm the anticipated molecular weight (approximately 70 kDa)

  • Include negative controls (cells with no or low ZNF23 expression)

  • Use siRNA or CRISPR knockout of ZNF23 to demonstrate specificity

• Peptide Competition Assay:

  • Pre-incubate the antibody with excess immunizing peptide

  • Run parallel blots/staining with blocked and unblocked antibody

  • Signal should be reduced or eliminated in the peptide-blocked condition

  • This approach is particularly useful for validating antibodies raised against specific peptides

• Overexpression Validation:

  • Compare endogenous ZNF23 detection with overexpressed ZNF23

  • Tag ZNF23 with a reporter (e.g., GFP) and confirm co-localization

  • The antibody should detect both endogenous and exogenous protein

• Cross-platform Validation:

  • Confirm consistent results across different techniques (WB, IHC, IF)

  • Verify subcellular localization matches known distribution (nuclear)

  • Compare results from multiple antibodies targeting different epitopes

• Enhanced Validation Methods:

  • Recombinant expression validation, as used for some commercial antibodies

  • Genetic knockout validation when possible

  • Orthogonal validation using mass spectrometry

These validation steps are crucial for ensuring experimental rigor and reproducibility in ZNF23 research.

How can ZNF23 antibodies be used to investigate its role in cancer progression?

ZNF23 antibodies can be powerful tools for investigating this protein's role in cancer through multiple approaches:

• Expression Profiling:

  • Use immunohistochemistry to analyze ZNF23 expression across cancer stages and grades

  • Create tissue microarrays to efficiently screen multiple cancer samples

  • Correlate expression patterns with clinical outcomes and patient survival

  • Previous studies have shown that ZNF23 levels are reduced or lost in human cancers, suggesting a tumor suppressor role

• Mechanistic Studies:

  • Use immunoprecipitation with ZNF23 antibodies to identify interaction partners

  • Perform chromatin immunoprecipitation (ChIP) to identify genomic binding sites

  • Investigate changes in ZNF23 subcellular localization during cancer progression

  • Study post-translational modifications affecting ZNF23 function

• Functional Investigations:

  • Manipulate ZNF23 expression in cell lines and xenograft models

  • Monitor effects on cell cycle using flow cytometry

  • Examine p27(kip-1) expression and cell cycle arrest in G1 phase

  • Assess proliferation, apoptosis, and migration in response to ZNF23 modulation

• Diagnostic Development:

  • Evaluate ZNF23 as a diagnostic biomarker for early cancer detection

  • Develop standardized scoring systems for ZNF23 immunohistochemistry

  • Investigate correlation with other established cancer markers

  • As noted in previous research, ZNF23 antibodies may be valuable for "carrier detection, diagnosis, or therapy for cancer"

These approaches can help elucidate the mechanisms by which ZNF23 downregulation contributes to carcinogenesis and potentially identify new therapeutic targets.

What methodologies can be used to study ZNF23 interactions with other proteins?

Protein Interaction Study Methods:

• Co-Immunoprecipitation (Co-IP):

  • Lyse cells under non-denaturing conditions

  • Immunoprecipitate ZNF23 using specific antibodies

  • Analyze co-precipitated proteins by Western blotting or mass spectrometry

  • Perform reverse Co-IP to confirm interactions

  • Particularly useful for identifying novel binding partners of ZNF23

• Proximity Ligation Assay (PLA):

  • Use ZNF23 antibody and antibodies against suspected interaction partners

  • Apply species-specific secondary antibodies with attached oligonucleotides

  • Fluorescent signal is generated only when proteins are in close proximity

  • Allows visualization of protein interactions in situ with subcellular resolution

  • Particularly valuable given ZNF23's nuclear localization

• Bimolecular Fluorescence Complementation (BiFC):

  • Fuse ZNF23 and potential partners to complementary fragments of a fluorescent protein

  • When proteins interact, the fragments reconstitute a functional fluorophore

  • Allows direct visualization of protein interactions in living cells

  • Can reveal subcellular localization of interactions

• Pull-down Assays:

  • Express recombinant ZNF23 with affinity tags

  • Use as bait to capture interaction partners from cell lysates

  • Identify binding proteins by mass spectrometry

  • Validate interactions using ZNF23 antibodies

  • Useful for identifying both direct and indirect interactions

• Chromatin Immunoprecipitation (ChIP):

  • Use ZNF23 antibodies to immunoprecipitate protein-DNA complexes

  • Identify DNA binding sites using sequencing (ChIP-seq)

  • Particularly relevant as ZNF23 contains zinc fingers and may function in transcriptional regulation

These methodologies can help elucidate ZNF23's functional network and its role in cell cycle regulation and tumor suppression.

How can I design experiments to study the relationship between ZNF23 and p27(kip-1) in cell cycle regulation?

Experimental Design for ZNF23 and p27(kip-1) Studies:

• Expression Correlation Analysis:

  • Manipulate ZNF23 expression through overexpression or knockdown

  • Measure corresponding changes in p27(kip-1) at protein and mRNA levels

  • Use Western blotting with antibodies against both proteins

  • Perform qRT-PCR to determine if regulation occurs at transcriptional level

  • Previous research has shown that ectopic ZNF23 expression enhances p27(kip-1) expression

• Promoter Analysis Studies:

  • Perform ChIP using ZNF23 antibodies to determine if ZNF23 binds the p27(kip-1) promoter

  • Design luciferase reporter assays with p27(kip-1) promoter constructs

  • Test ZNF23 truncation mutants to identify domains required for p27(kip-1) regulation

  • Focus on C-terminal zinc fingers, as deletion analysis has shown they are critical for ZNF23's function

• Rescue Experiments:

  • Knockdown p27(kip-1) using siRNA in cells overexpressing ZNF23

  • Measure cell cycle parameters and proliferation

  • Verify reversibility of ZNF23-induced growth inhibition

  • This approach has been validated in previous studies

• Cell Cycle Analysis:

  • Use flow cytometry to quantify cell cycle distribution

  • Measure BrdU incorporation to assess S-phase entry

  • Monitor cyclin-CDK activities in response to ZNF23 modulation

  • Quantify G1 arrest, which is the primary cell cycle effect of ZNF23

• p53-independent Pathway Investigation:

  • Compare ZNF23 effects in p53-wild-type and p53-null cell lines

  • Identify p53-independent effectors downstream of ZNF23

  • Investigate cross-talk with other cell cycle regulators

  • Previous work has demonstrated that ZNF23's growth-inhibitory effect is p53-independent

These experiments will help elucidate the mechanistic pathway connecting ZNF23 to p27(kip-1) and cell cycle regulation, potentially revealing new targets for cancer therapy.