ZNF232 Antibody

What is ZNF232 and what is its biological function?

ZNF232 (also known as ZSCAN11) is a zinc finger protein belonging to the krueppel C2H2-type zinc-finger protein family. It contains one SCAN box domain and five C2H2-type zinc fingers . ZNF232 is primarily involved in transcriptional regulation, though its precise functional mechanisms remain under investigation . The protein shows ubiquitous expression pattern with higher expression levels detected in the liver, testis, and ovary . At the subcellular level, ZNF232 is primarily localized to the nucleus, consistent with its predicted role in transcriptional regulation .

Understanding this protein's function is essential for designing appropriate experimental controls when using ZNF232 antibodies, particularly when investigating tissue-specific or developmental expression patterns.

What types of ZNF232 antibodies are currently available for research?

Both polyclonal and monoclonal antibodies against ZNF232 are currently available for research applications. These include:

The choice between polyclonal and monoclonal antibodies depends on your specific research needs. Polyclonal antibodies typically recognize multiple epitopes, potentially offering greater sensitivity but with some risk of cross-reactivity. Monoclonal antibodies recognize a single epitope, generally providing higher specificity but potentially reduced sensitivity compared to polyclonal options .

How do I determine the optimal working dilution for a ZNF232 antibody?

Determining the optimal working dilution for a ZNF232 antibody requires systematic titration based on your specific application and sample type. For example:

For the Sigma HPA027309 antibody, the recommended dilutions are:

• Immunoblotting: 0.04-0.4 μg/mL

• Immunohistochemistry: 1:50-1:200

For the G-Biosciences polyclonal antibody:

• Immunohistochemistry: 1/100 - 1/300

• ELISA: 1/5000

To determine the optimal working dilution for your specific experimental conditions:

• Begin with the manufacturer's recommended dilution range

• Prepare a series of dilutions (typically 2-fold or 5-fold) around this range

• Test these dilutions on positive control samples known to express ZNF232

• Include negative controls (samples known not to express ZNF232 or primary antibody omission)

• Evaluate signal-to-noise ratio across different dilutions

• Select the dilution that provides the strongest specific signal with minimal background

This methodical approach will ensure optimal antibody performance while conserving valuable reagents.

What validation methods confirm ZNF232 antibody specificity?

Validation of ZNF232 antibody specificity requires multiple complementary approaches:

• Western blotting validation: Confirms antibody recognizes a protein of the expected molecular weight. For ZNF232, this validates detection of the target protein in denatured form .

• Immunohistochemistry on tissue arrays: Several ZNF232 antibodies have been validated on human tissue arrays. The Sigma HPA027309 antibody, for example, has been tested on arrays containing 44 normal human tissues and 20 common cancer types .

• Protein array screening: Cross-reactivity testing against multiple protein targets. The Sigma antibody was tested on arrays containing 364 human recombinant protein fragments .

• Peptide competition assays: Pre-incubation of the antibody with the immunizing peptide should abolish specific binding signals.

• Genetic validation: Testing antibody on samples with knockout/knockdown of ZNF232 or on samples overexpressing ZNF232 (e.g., GFP-ZNF232 fusion protein) .

A truly validated antibody should show consistent results across multiple validation methods, with evidence of both sensitivity (detecting ZNF232 when present) and specificity (not detecting other unrelated proteins).

How can epitope selection impact ZNF232 antibody performance?

The choice of epitope significantly impacts ZNF232 antibody performance across different applications. When selecting a ZNF232 antibody, consider:

The immunogen sequence used for the Sigma HPA027309 antibody is: "SWYEPSAELVQTRMAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILEFL" , which represents a specific region of the ZNF232 protein.

The G-Biosciences antibody uses a synthesized peptide derived from human ZNF232, specifically from amino acids 171-220 .

The epitope location can affect antibody utility in different ways:

• Structural accessibility: Epitopes in buried regions may be inaccessible in native protein conformations

• Domain-specific detection: Antibodies targeting the SCAN domain versus zinc finger domains may perform differently

• Post-translational modifications: Epitopes containing modification sites may be masked

• Species cross-reactivity: Conserved epitopes provide broader species reactivity

What are the best practices for detecting low-abundance ZNF232 in challenging samples?

Detecting low-abundance ZNF232 in challenging samples requires optimization beyond standard protocols:

• Sample preparation optimization:

  • For tissue samples: Test multiple fixation protocols (freshly prepared 4% PFA shows superior epitope preservation)

  • For cell lysates: Compare different lysis buffers (RIPA versus NP-40 based)

  • Include phosphatase and protease inhibitors freshly in all extraction buffers

• Signal amplification strategies:

  • For IHC/ICC: Consider tyramide signal amplification (TSA) systems

  • For Western blotting: Use high-sensitivity ECL substrates or fluorescent secondary antibodies

  • For low abundance detection: Consider proximity ligation assay (PLA) for single-molecule sensitivity

• Enrichment approaches:

  • Immunoprecipitation before Western blotting

  • Subcellular fractionation (particularly nuclear extraction for ZNF232)

  • Concentration of samples using TCA precipitation

• Reducing background interference:

  • Extensive blocking (5% BSA or milk may be insufficient; test 10% serum from secondary antibody species)

  • Longer/additional washing steps with 0.1-0.3% Tween-20

  • Pre-adsorption of secondary antibodies with tissue powder from the species being examined

These approaches should be methodically tested and compared to determine the optimal protocol for your specific sample type and detection method.

How do I design experiments to investigate ZNF232 protein-protein interactions?

Investigating ZNF232 protein-protein interactions requires careful experimental design:

• Co-immunoprecipitation (Co-IP) approach:

  • Use anti-ZNF232 antibody for pulldown (e.g., Sigma HPA027309)

  • Verify IP efficiency by blotting a small fraction (10%) for ZNF232

  • Blot remaining sample for suspected interaction partners

  • Critical controls: IgG-only control, reverse Co-IP (pull down with antibody against suspected partner)

• Proximity-based methods:

  • BioID approach: Express ZNF232-BirA fusion and identify biotinylated proximity partners

  • APEX approach: Express ZNF232-APEX2 fusion for peroxidase-based labeling of proximal proteins

  • These methods capture both stable and transient interactions in living cells

• Domain-specific interaction mapping:

  • Create truncation constructs of ZNF232 to map interaction domains

  • Focus on the SCAN domain (known for mediating protein-protein interactions)

  • Test the five C2H2-type zinc fingers independently

• Confirmation by orthogonal methods:

  • Fluorescence resonance energy transfer (FRET)

  • Fluorescence complementation assays

  • Mammalian two-hybrid assays

Remember that ZNF232 is primarily nuclear-localized , so experimental conditions should preserve nuclear integrity and nuclear protein-protein interactions.

What are the critical considerations when comparing ZNF232 expression across different tissue types?

Comparing ZNF232 expression across different tissue types presents several methodological challenges:

• Tissue-specific expression patterns:

  • ZNF232 shows ubiquitous expression with higher levels in liver, testis, and ovary

  • Expression may vary significantly between normal and disease tissues

• Technical normalization approaches:

  • For Western blotting: Use multiple housekeeping proteins (β-actin alone is insufficient)

  • For immunohistochemistry: Standardize fixation times and antigen retrieval procedures

  • For qRT-PCR: Validate reference genes in each tissue type separately

• Analysis considerations:

  • Implement quantitative image analysis for IHC (e.g., H-score, Allred scoring)

  • Account for tissue-specific background levels

  • Consider cell type heterogeneity within tissue samples

• Validation strategies:

  • Confirm protein expression using orthogonal methods (e.g., RNA-seq, proteomics)

  • Include positive control tissues (liver, testis, ovary for ZNF232)

  • Include negative controls (tissues with minimal expression)

What are common causes of false negative results when using ZNF232 antibodies?

False negative results when using ZNF232 antibodies can occur for several technical reasons:

• Epitope masking issues:

  • Overfixation in formalin (especially for FFPE tissues)

  • Insufficient or inappropriate antigen retrieval

  • Epitope blocked by protein-protein interactions

• Protocol optimization gaps:

  • Incorrect antibody dilution (too dilute)

  • Insufficient incubation time or temperature

  • Suboptimal buffer composition

• Sample preparation problems:

  • Protein degradation during extraction

  • Inefficient transfer in Western blotting

  • Protein loss during sample processing

• Detection limitations:

  • Insufficient sensitivity of detection system

  • High background masking low-level signals

  • Suboptimal imaging settings

To systematically address potential false negatives:

• Include known positive control samples (e.g., liver tissue or liver-derived cell lines)

• Test multiple antigen retrieval methods (heat-induced vs. enzymatic)

• Try signal amplification methods (TSA, enhanced chemiluminescence)

• Consider concentrated antibody incubation at 4°C overnight rather than 1-2 hours at room temperature

• Test alternative antibodies targeting different ZNF232 epitopes

How do I interpret contradictory results between different ZNF232 antibodies?

Contradictory results between different ZNF232 antibodies require systematic investigation:

• Epitope differences analysis:

  • Map the exact epitopes recognized by each antibody

  • Determine if epitopes might be differentially accessible in various experimental conditions

  • Consider if post-translational modifications might affect epitope recognition

• Validation status comparison:

  • Review validation data for each antibody (Western blotting, IHC, knockout controls)

  • Assess the rigor of validation (single vs. multiple validation methods)

  • Check for potential lot-to-lot variation issues

• Protocol-dependent factors:

  • Test whether contradictions persist across different applications (WB vs. IHC)

  • Evaluate if contradictions are sample-type dependent

  • Determine if different fixation/extraction methods yield consistent results

• Resolution strategies:

  • Perform genetic validation (siRNA knockdown, CRISPR knockout)

  • Use orthogonal methods (mass spectrometry, RNA analysis)

  • Consider splice variant or isoform-specific detection

For definitive studies, prioritize antibodies with extensive validation data, such as those tested on protein arrays and in multiple applications, like the Sigma HPA027309 antibody that has been validated in both Western blotting and immunohistochemistry applications .

What controls are essential when using ZNF232 antibodies for immunohistochemistry?

When using ZNF232 antibodies for immunohistochemistry, implement these essential controls:

• Positive tissue controls:

  • Include liver, testis, or ovary sections (known to express higher levels of ZNF232)

  • Process and stain simultaneously with test samples

• Negative tissue controls:

  • Include tissues known to have minimal ZNF232 expression

  • Squamous epidermis cells have been reported to lack ZNF32 expression , which may provide insight for ZNF232 studies as well

• Technical negative controls:

  • Primary antibody omission (secondary antibody only)

  • Isotype control (irrelevant antibody of same isotype and concentration)

  • Peptide competition/blocking (pre-incubation with immunizing peptide)

• Procedural controls:

  • Antigen retrieval verification (internal positive control protein)

  • Endogenous peroxidase blocking verification

  • Species cross-reactivity assessment

• Specificity confirmation:

  • Compare staining patterns with multiple ZNF232 antibodies

  • Correlate with in situ hybridization or RNAscope for ZNF232 mRNA

For accurate interpretation, document all staining patterns (nuclear, cytoplasmic, membranous) since ZNF232 is primarily expected to show nuclear localization .

How can I optimize ZNF232 antibody performance for Western blotting applications?

Optimizing ZNF232 antibody performance for Western blotting requires attention to multiple parameters:

• Sample preparation optimization:

  • Test multiple lysis buffers (RIPA, NP-40, SDS-based)

  • Include appropriate protease inhibitor cocktails

  • Consider nuclear extraction protocols to enrich for ZNF232

• Protein loading and transfer considerations:

  • For the Sigma HPA027309 antibody, use 0.04-0.4 μg/mL for immunoblotting

  • Optimize protein loading (20-50 μg total protein per lane)

  • Test different transfer methods (wet vs. semi-dry) and transfer times

• Blocking optimization:

  • Compare BSA vs. non-fat dry milk blocking (typically 5%)

  • Test Tween-20 concentrations in wash buffers (0.05-0.1%)

  • Consider specialized blocking reagents for problematic samples

• Detection strategies:

  • For weak signals: Use high-sensitivity ECL or fluorescent secondary antibodies

  • For high background: Increase washing stringency and duration

  • For multiple bands: Consider gradient gels for better resolution

• Antibody incubation parameters:

  • Test both room temperature (1-2 hours) and 4°C overnight incubations

  • Optimize antibody dilution through systematic titration

  • Consider carrier protein addition (0.5% BSA) to primary antibody dilution

When troubleshooting, remember that the predicted molecular weight of ZNF232 is approximately 45 kDa, but post-translational modifications might alter migration patterns.

How can ZNF232 antibodies be utilized in cancer research?

ZNF232 antibodies offer several valuable applications in cancer research:

• Expression profiling in tumors:

  • ZNF32 (a related zinc finger protein) has been detected in pulmonary squamous carcinoma cells but not in normal squamous epidermis

  • Similar differential expression patterns may exist for ZNF232

  • Antibodies like Sigma HPA027309 have been tested on arrays containing 20 common cancer types

• Prognostic biomarker evaluation:

  • Quantitative immunohistochemistry to correlate ZNF232 expression with patient outcomes

  • Tissue microarray analysis across cancer subtypes

  • Correlation with clinical parameters and treatment response

• Functional studies in cancer biology:

  • Chromatin immunoprecipitation (ChIP) to identify ZNF232 target genes in cancer cells

  • Co-localization with other transcriptional regulators in cancer progression

  • Assessment of subcellular localization changes during malignant transformation

• Therapeutic target assessment:

  • Monitoring ZNF232 expression changes in response to treatment

  • Identifying cancer subtypes with aberrant ZNF232 expression

  • Testing antibody-drug conjugates in preclinical models

For cancer research applications, immunohistochemistry protocols typically use dilutions of 1:50-1:200 for the Sigma antibody or 1:100-1:300 for the G-Biosciences antibody , with optimization recommended for each specific tumor type.

What methodological advances are improving ZNF232 detection sensitivity and specificity?

Recent methodological advances have enhanced ZNF232 detection:

• Advanced antibody development technologies:

  • Epitope mapping for optimal immunogen selection

  • Recombinant antibody technologies with defined binding sites

  • Hybridoma technology producing stable anti-ZNF32-8D9 clones has demonstrated high sensitivity and specificity , suggesting similar approaches could benefit ZNF232 antibody development

• Signal amplification innovations:

  • Tyramide signal amplification systems

  • Quantum dot-conjugated secondary antibodies

  • Polymer-based detection systems

• Multiplexed detection approaches:

  • Multiplex immunofluorescence for co-expression studies

  • Mass cytometry (CyTOF) for single-cell protein detection

  • Digital spatial profiling for quantitative tissue analysis

• Validation technologies:

  • CRISPR/Cas9 knockout validation systems

  • Automated antibody validation platforms

  • Artificial intelligence-assisted image analysis for specificity assessment

When implementing these advanced methods, maintain appropriate controls and benchmark against established detection protocols to ensure reliable interpretation of ZNF232 expression and localization data.

How can ZNF232 antibodies contribute to understanding transcriptional regulation mechanisms?

ZNF232 antibodies can provide critical insights into transcriptional regulation mechanisms:

• Chromatin interaction mapping:

  • ChIP-seq to identify genomic binding sites of ZNF232

  • CUT&RUN or CUT&Tag for higher resolution binding profiles

  • Re-ChIP to identify co-occupancy with other transcription factors

• Protein complex characterization:

  • Immunoprecipitation followed by mass spectrometry (IP-MS)

  • Proximity labeling (BioID, APEX) with ZNF232 as bait

  • Co-immunoprecipitation to validate specific interactions

• Dynamic regulation studies:

  • Chromatin fractionation to assess ZNF232 binding in different chromatin states

  • Live-cell imaging with anti-ZNF232 nanobodies

  • Cell cycle-dependent changes in ZNF232 localization and activity

• Functional genomics integration:

  • Correlation of ZNF232 binding with gene expression changes

  • Integration with epigenomic data (histone modifications, DNA methylation)

  • Motif analysis of ZNF232 binding sites

For these applications, antibody specificity is paramount. The extensive validation of antibodies like Sigma HPA027309 on protein arrays containing 364 human recombinant protein fragments provides confidence in specificity for advanced transcriptional studies.

What considerations are important when studying ZNF232 in developmental biology?

Studying ZNF232 in developmental biology requires special methodological considerations:

• Developmental timing assessment:

  • Stage-specific expression analysis using consistent antibody dilutions

  • Comparison across embryonic, fetal, and adult tissues

  • Correlation with developmental transcriptomics data

• Tissue-specific expression patterns:

  • ZNF232 shows ubiquitous expression with enrichment in liver, testis, and ovary

  • Developmental shifts in tissue-specific expression should be monitored

  • Special attention to reproductive tissue development given adult expression patterns

• Technical adaptations for developmental samples:

  • Modified fixation protocols for embryonic tissues

  • Antigen retrieval optimization for developing organs

  • Background reduction strategies for embryonic tissues (which often show higher background)

• Functional assessment approaches:

  • Conditional knockout models with temporal control

  • Ex vivo organ culture with ZNF232 antibody applications

  • Correlation of expression with developmental milestones

• Comparative developmental biology:

  • Cross-species conservation of expression patterns

  • Evolutionary conservation of ZNF232 function

  • Paralog compensation assessment during development

These developmental studies benefit from comparing multiple antibodies targeting different ZNF232 epitopes to ensure consistent detection across developmental stages when protein conformation or modifications may vary.