ZNF256 Antibody

Shipped with Ice Packs
In Stock

Product Specs

Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
We typically dispatch orders within 1-3 business days of receipt. Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributor.
Synonyms
anti BMZF3 antibody; BMZF 3 antibody; BMZF-3 antibody; BMZF3 antibody antibody; Bone marrow zinc finger 3 antibody; Zinc finger protein 256 antibody; ZN256_HUMAN antibody; ZNF256 antibody
Target Names
ZNF256
Uniprot No.

Target Background

Function
ZNF256 Antibody is a transcriptional repressor involved in cell proliferation. It requires TRIM28 for its activity.
Database Links

HGNC: 13049

OMIM: 606956

KEGG: hsa:10172

STRING: 9606.ENSP00000282308

UniGene: Hs.596242

Protein Families
Krueppel C2H2-type zinc-finger protein family
Subcellular Location
Nucleus.

Q&A

What is ZNF256 and what functional role does it play in cellular processes?

ZNF256 (Zinc Finger Protein 256) is a transcription factor belonging to the krueppel C2H2-type zinc-finger protein family. It functions primarily as a transcriptional repressor that plays a significant role in cell proliferation. ZNF256 requires TRIM28 (also known as KAP1) for its activity, suggesting it operates within a larger transcriptional regulatory complex. As a transcription factor, ZNF256 regulates the expression of genes involved in cell growth, differentiation, and development, making it an important subject for research investigating normal cell function and disease progression . Two isoforms of the human protein are produced by alternative splicing, which may have distinct functional properties in different cellular contexts .

What structural characteristics define ZNF256 protein?

ZNF256 is characterized by its C2H2-type zinc finger domains that facilitate DNA binding. The protein contains multiple zinc finger motifs that recognize specific DNA sequences, allowing for targeted regulation of gene expression. As a member of the krueppel C2H2-type zinc-finger protein family, ZNF256 likely shares structural similarities with other members of this extensive transcription factor family . The protein also contains domains that mediate interactions with cofactors such as TRIM28, which is required for its transcriptional repressive activity . This structural organization enables ZNF256 to function as a sequence-specific transcriptional regulator in various biological processes.

How can researchers determine if ZNF256 is expressed in their experimental system?

Researchers can employ several complementary approaches to assess ZNF256 expression:

  • Western blotting: Using validated ZNF256 antibodies to detect protein expression in cell or tissue lysates. The expected molecular weight should align with the protein's predicted size.

  • Immunohistochemistry/Immunofluorescence: These techniques can visualize ZNF256 expression in tissue sections or cultured cells, providing information on both expression levels and subcellular localization .

  • RT-qPCR: Quantifying ZNF256 mRNA expression provides an alternative measure of gene expression that can complement protein-level analyses.

  • RNA-seq or microarray data: Examining existing transcriptomic datasets can provide preliminary evidence of ZNF256 expression across different tissues or experimental conditions.

For reliable results, researchers should implement appropriate controls, including positive control samples known to express ZNF256 and negative controls (such as ZNF256 knockdown samples). This multi-modal approach ensures confident determination of ZNF256 expression in any experimental system.

What are the critical factors to consider when selecting a ZNF256 antibody for research?

When selecting a ZNF256 antibody, researchers should evaluate several key factors:

  • Antibody type: Consider whether a monoclonal or polyclonal antibody better suits your application. Polyclonal antibodies like the ZNF256 Antibody PACO13322 recognize multiple epitopes, potentially providing stronger signals, while monoclonal antibodies offer higher specificity for a single epitope .

  • Validated applications: Ensure the antibody has been validated for your specific application. For example, the ZNF256 Antibody from Novus Biologicals (NBP247569) is validated for immunohistochemistry, immunocytochemistry/immunofluorescence, and immunohistochemistry-paraffin applications with specific recommended dilutions .

  • Species reactivity: Verify the antibody recognizes ZNF256 in your species of interest. The available antibodies are typically reactive with human ZNF256 .

  • Epitope information: Understanding which region of ZNF256 the antibody recognizes can be important, especially if studying specific domains or isoforms.

  • Published validation data: Review available validation data, including western blots showing specificity and immunohistochemistry images demonstrating proper localization.

Selecting an appropriate antibody that has been rigorously validated for your specific application is critical for generating reliable and reproducible results in ZNF256 research.

How should researchers validate a ZNF256 antibody before use in their experiments?

A comprehensive validation strategy for ZNF256 antibodies should include:

  • Specificity validation:

    • Western blot analysis to confirm detection of protein at the expected molecular weight

    • Peptide competition assays to verify epitope specificity

    • Testing in ZNF256 knockout or knockdown systems to confirm signal reduction

  • Application-specific validation:

    • For immunohistochemistry: Optimize antigen retrieval methods and antibody dilutions (e.g., 1:200-1:500 as recommended for the Novus Biologicals antibody)

    • For immunofluorescence: Confirm proper nuclear localization consistent with transcription factor function

    • For ChIP applications: Verify enrichment of known or predicted ZNF256 binding sites

  • Positive and negative controls:

    • Use tissues or cells with known ZNF256 expression as positive controls

    • Include appropriate negative controls (primary antibody omission, isotype controls)

    • Consider using overexpression systems as additional positive controls

  • Cross-reactivity assessment:

    • Test in systems with related zinc finger proteins to ensure specificity

    • Examine potential cross-reactivity with other C2H2-type zinc finger family members

This systematic validation approach ensures that experimental results with ZNF256 antibodies are reliable and interpretable.

What are the differences between commercially available ZNF256 antibodies?

Commercial ZNF256 antibodies differ in several important characteristics that may influence experimental outcomes:

CharacteristicZNF256 Antibody (PACO13322)ZNF256 Antibody (NBP247569)
Host SpeciesRabbitRabbit
ClonalityPolyclonalPolyclonal
Validated ApplicationsELISAIHC, ICC/IF, IHC-Paraffin
Recommended DilutionsNot specifiedIHC: 1:200-1:500, ICC/IF: 1-4 μg/ml
Species ReactivityHumanHuman
ImmunogenHuman ZNF256Recombinant protein (amino acids: NLTLTTSLGGSGAGDEEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEIC)
Purification MethodAntigen Affinity PurifiedAffinity Purified
IsotypeIgGIgG
Storage BufferPBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

When selecting between these antibodies, researchers should consider the specific application requirements, the importance of epitope location, and available validation data. The antibody from Novus Biologicals provides more detailed application protocols with specific dilution recommendations, which may be beneficial for researchers new to working with ZNF256 .

What is the optimal protocol for detecting ZNF256 by immunohistochemistry?

Optimized Immunohistochemistry Protocol for ZNF256 Detection:

  • Sample Preparation:

    • Fix tissue in 10% neutral buffered formalin for 24-48 hours

    • Process, embed in paraffin, and section at 4-6 μm thickness

    • Mount sections on positively charged slides

  • Deparaffinization and Antigen Retrieval:

    • Deparaffinize sections in xylene and rehydrate through graded alcohols

    • Perform heat-induced epitope retrieval using citrate buffer (pH 6.0) in a pressure cooker or microwave

    • Allow slides to cool to room temperature (approximately 20 minutes)

  • Immunostaining:

    • Block endogenous peroxidase with 3% hydrogen peroxide for 10 minutes

    • Block non-specific binding with 5% normal serum (from secondary antibody host species)

    • Apply ZNF256 antibody at optimal dilution (1:200-1:500 for NBP247569)

    • Incubate overnight at 4°C in a humidified chamber

    • Wash thoroughly with PBS containing 0.1% Tween-20 (3 × 5 minutes)

    • Apply appropriate HRP-conjugated secondary antibody and incubate for 30-60 minutes

    • Wash thoroughly with PBS-T

    • Develop with DAB substrate until optimal signal is achieved

    • Counterstain with hematoxylin, dehydrate, clear, and mount

  • Controls and Validation:

    • Include positive control tissue known to express ZNF256

    • Include negative controls (primary antibody omission or isotype control)

    • Evaluate nuclear localization consistent with transcription factor function

This protocol should be optimized for specific tissue types and fixation conditions, with particular attention to antigen retrieval methods which can significantly impact staining quality for nuclear transcription factors like ZNF256.

How can ZNF256 antibodies be utilized in chromatin immunoprecipitation (ChIP) experiments?

ChIP Protocol for ZNF256 Binding Site Identification:

  • Experimental Design Considerations:

    • Select cell types with verified ZNF256 expression

    • Consider experimental conditions that might affect ZNF256 binding (e.g., differentiation states, treatments)

    • Plan appropriate controls: input chromatin, IgG control, positive control (another transcription factor)

  • Chromatin Preparation:

    • Crosslink cells with 1% formaldehyde for 10 minutes at room temperature

    • Quench with glycine (final concentration 0.125 M)

    • Lyse cells and isolate nuclei

    • Sonicate chromatin to generate fragments of 200-500 bp

    • Confirm fragmentation by agarose gel electrophoresis

  • Immunoprecipitation:

    • Pre-clear chromatin with protein A/G beads

    • Divide chromatin for experimental IP (ZNF256 antibody), IgG control, and input samples

    • Add 3-5 μg of ZNF256 antibody to experimental samples

    • Incubate overnight at 4°C with rotation

    • Add protein A/G beads and incubate for additional 2-4 hours

    • Perform sequential washes with increasing stringency

  • DNA Recovery and Analysis:

    • Reverse crosslinks at 65°C overnight

    • Treat with RNase A and Proteinase K

    • Purify DNA using column-based methods

    • Analyze by qPCR for specific target regions or perform ChIP-seq for genome-wide binding profile

  • Data Analysis:

    • For ChIP-qPCR: Calculate percent input or fold enrichment compared to IgG control

    • For ChIP-seq: Identify peaks using appropriate algorithms and perform motif analysis to identify ZNF256 binding motifs

This protocol takes advantage of the ZNF256 antibody's specificity to identify genomic regions bound by this transcription factor, providing insights into its regulatory targets and mechanisms .

What approaches can be used to study ZNF256 interactions with TRIM28 and other protein partners?

ZNF256 requires TRIM28 for its transcriptional repression activity , making the study of this interaction particularly important. Several approaches can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Lyse cells in non-denaturing buffer (e.g., 150 mM NaCl, 50 mM Tris-HCl pH 7.5, 1% NP-40)

    • Immunoprecipitate with ZNF256 antibody

    • Analyze precipitated proteins by western blot for TRIM28 and other suspected interactors

    • Perform reciprocal Co-IP with TRIM28 antibody to confirm interaction

  • Proximity Ligation Assay (PLA):

    • Use primary antibodies against ZNF256 and TRIM28 from different host species

    • Apply species-specific PLA probes followed by ligation and amplification

    • Visualize interaction sites as fluorescent spots by microscopy

    • Quantify signals to assess interaction frequency

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of ZNF256 and TRIM28 with complementary fragments of a fluorescent protein

    • Co-express in cells and monitor reconstitution of fluorescence

    • Analyze subcellular localization of interactions

  • Mass Spectrometry-Based Interactome Analysis:

    • Immunoprecipitate ZNF256 under various conditions

    • Identify co-precipitated proteins using mass spectrometry

    • Validate key interactions using orthogonal methods

  • FRET-Based Interaction Studies:

    • Generate fluorescently-tagged ZNF256 and TRIM28

    • Measure FRET efficiency to assess proximity and interaction

These complementary approaches provide a comprehensive view of ZNF256's protein interaction network, which is crucial for understanding its molecular mechanisms in transcriptional regulation .

How should researchers analyze ZNF256 binding patterns from ChIP-seq experiments?

Analyzing ZNF256 ChIP-seq data requires a systematic approach:

  • Quality Control and Preprocessing:

    • Assess sequencing quality metrics (base quality, read duplication)

    • Align reads to reference genome using appropriate aligner (e.g., Bowtie2, BWA)

    • Remove PCR duplicates and filter low-quality alignments

    • Generate normalized coverage tracks for visualization

  • Peak Calling and Annotation:

    • Identify ZNF256 binding sites using peak-calling algorithms (e.g., MACS2)

    • Use appropriate controls (input DNA or IgG ChIP) for background correction

    • Annotate peaks relative to genomic features (promoters, enhancers, etc.)

    • Identify genes proximal to binding sites for functional analysis

  • Motif Analysis:

    • Perform de novo motif discovery within peak regions to identify ZNF256 binding preferences

    • Scan for known motifs of potential co-factors

    • Analyze motif distribution relative to peak centers

  • Comparative Analysis:

    • Compare binding patterns across different conditions or cell types

    • Integrate with gene expression data to identify direct regulatory targets

    • Examine overlap with chromatin accessibility data (ATAC-seq, DNase-seq)

  • Functional Enrichment Analysis:

    • Perform Gene Ontology and pathway analysis of genes associated with ZNF256 binding sites

    • Identify biological processes potentially regulated by ZNF256

  • Visualization and Interpretation:

    • Generate genome browser tracks for visual inspection of binding patterns

    • Create heatmaps showing binding intensity across genomic features

    • Produce meta-profiles of binding patterns at specific genomic elements

This analytical framework provides a comprehensive understanding of ZNF256's genomic binding landscape and regulatory function .

What approaches can be used to correlate ZNF256 expression with cellular phenotypes?

To establish relationships between ZNF256 expression and cellular phenotypes, researchers can employ several methodological approaches:

  • Loss-of-Function Studies:

    • siRNA/shRNA knockdown of ZNF256 followed by phenotypic assays

    • CRISPR/Cas9-mediated knockout to completely eliminate expression

    • Analysis of cell proliferation, differentiation, migration, or other relevant phenotypes

    • Rescue experiments to confirm specificity

  • Gain-of-Function Studies:

    • Overexpression of ZNF256 using expression vectors

    • Inducible expression systems to control timing and level of expression

    • Correlation of expression levels with phenotypic outcomes

  • Correlation Studies in Cell Lines or Tissues:

    • Quantify ZNF256 expression using immunohistochemistry or western blotting

    • Measure relevant phenotypic markers simultaneously

    • Perform statistical correlation analysis between expression and phenotypes

    • Consider multivariate analysis to account for confounding factors

  • Time-Course Studies:

    • Monitor ZNF256 expression during biological processes (e.g., differentiation)

    • Correlate temporal expression patterns with phenotypic changes

    • Use live-cell imaging combined with reporter systems

  • Patient-Derived Samples:

    • Compare ZNF256 expression in normal versus diseased tissues

    • Correlate expression with clinical parameters and outcomes

    • Perform multivariate regression analysis to identify independent associations

This multifaceted approach provides robust evidence for causal relationships between ZNF256 expression and specific cellular phenotypes, helping to elucidate its functional roles in normal physiology and disease .

How can researchers integrate ZNF256 ChIP-seq data with transcriptomic data for comprehensive analysis?

Integrative analysis of ZNF256 binding and gene expression data provides powerful insights into its regulatory functions:

  • Linking Binding Sites to Target Genes:

    • Assign ZNF256 binding sites to potential target genes based on proximity

    • Consider alternative approaches beyond proximity (e.g., chromatin conformation data)

    • Categorize binding events by genomic location (promoters, enhancers, etc.)

  • Correlation Analysis:

    • Calculate correlation between binding strength (peak intensity) and gene expression levels

    • Identify positively and negatively correlated genes as potential direct targets

    • Generate scatter plots or heatmaps to visualize these relationships

  • Differential Analysis:

    • Compare ZNF256 binding patterns with differential gene expression between conditions

    • Identify genes with both differential binding and expression changes

    • Categorize genes as potential direct targets (binding + expression change) or indirect targets

  • Gene Set Enrichment Analysis:

    • Perform pathway enrichment analysis of genes with ZNF256 binding sites

    • Compare enriched pathways with those identified in transcriptomic analysis

    • Identify biological processes potentially regulated by ZNF256

  • Network Analysis:

    • Construct gene regulatory networks incorporating ZNF256 binding data

    • Integrate with protein-protein interaction data (especially TRIM28 interactions)

    • Identify regulatory hubs and key target genes

  • Validation Approaches:

    • Select candidate targets for experimental validation

    • Perform reporter assays to confirm direct regulation

    • Use targeted gene expression analysis after ZNF256 manipulation

This integrated analysis framework provides a comprehensive understanding of ZNF256's role in transcriptional regulation and identifies the biological processes it influences .

What are common technical challenges when working with ZNF256 antibodies and how can they be addressed?

Researchers working with ZNF256 antibodies may encounter several technical challenges:

  • Weak or Absent Signal in Immunostaining:

    • Challenge: Nuclear proteins like ZNF256 may require optimized extraction or fixation methods

    • Solutions:

      • Test different antigen retrieval methods (heat-induced vs. enzymatic)

      • Optimize fixation conditions (duration, temperature)

      • Try signal amplification systems (TSA, polymer-based detection)

      • Ensure antibody concentration is optimal (test dilution series)

  • High Background in Western Blotting:

    • Challenge: Non-specific binding leading to multiple bands or high background

    • Solutions:

      • Increase blocking time or concentration

      • Use alternative blocking agents (milk vs. BSA)

      • Increase washing stringency and duration

      • Optimize antibody dilution and incubation conditions

      • Use more specific detection systems

  • Variability Between Experiments:

    • Challenge: Inconsistent results across replicates

    • Solutions:

      • Standardize all experimental conditions (fixation, antigen retrieval, etc.)

      • Use the same lot of antibody when possible

      • Include consistent positive and negative controls

      • Implement quantitative quality control measures

  • Cross-Reactivity with Related Proteins:

    • Challenge: ZNF256 belongs to a large family of C2H2 zinc finger proteins with structural similarities

    • Solutions:

      • Validate antibody specificity using knockout/knockdown controls

      • Perform peptide competition assays

      • Use alternative antibodies targeting different epitopes for confirmation

  • ChIP-Specific Challenges:

    • Challenge: Low enrichment in ChIP experiments

    • Solutions:

      • Optimize crosslinking conditions

      • Test different sonication/fragmentation methods

      • Increase antibody amount or chromatin concentration

      • Implement more sensitive detection methods for ChIP-qPCR

Addressing these challenges through systematic optimization and rigorous controls ensures reliable and reproducible results when working with ZNF256 antibodies .

What advanced experimental approaches can be used to study ZNF256 function beyond standard antibody applications?

Beyond standard antibody applications, several advanced techniques can provide deeper insights into ZNF256 function:

  • Genome Engineering Approaches:

    • CRISPR/Cas9-mediated gene editing to:

      • Create ZNF256 knockout cell lines

      • Introduce point mutations in functional domains

      • Generate epitope-tagged endogenous ZNF256 for improved detection

    • CRISPRi/CRISPRa for targeted repression or activation of ZNF256 expression

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize ZNF256 distribution in nuclear subdomains

    • Live-cell imaging with fluorescently tagged ZNF256 to track dynamics

    • FRAP (Fluorescence Recovery After Photobleaching) to analyze ZNF256 mobility at chromatin

    • Single-molecule tracking to study binding kinetics in living cells

  • Interactome Analysis:

    • Proximity labeling methods (BioID, APEX) to identify ZNF256 protein interaction partners

    • Mass spectrometry analysis of ZNF256 complexes under different conditions

    • ChIP-MS to identify chromatin-associated ZNF256 interactors

  • Functional Genomics:

    • ChIP-seq combined with ATAC-seq to correlate binding with chromatin accessibility

    • HiChIP or ChIA-PET to study 3D genome organization at ZNF256 binding sites

    • CUT&RUN or CUT&Tag for high-resolution mapping with fewer cells

  • Transcriptional Reporter Systems:

    • MS2/PP7 systems to visualize transcription dynamics at ZNF256 target genes

    • Luciferase-based reporters to quantify ZNF256-mediated repression

    • Inducible degradation systems to study temporal aspects of ZNF256 function

These advanced approaches extend beyond traditional antibody-based methods to provide mechanistic insights into ZNF256's function in gene regulation, nuclear organization, and cellular processes .

How can researchers investigate the role of ZNF256 in disease processes?

To investigate ZNF256's role in disease processes, researchers can implement several methodological approaches:

  • Expression Analysis in Disease Models:

    • Compare ZNF256 expression between normal and diseased tissues using:

      • Immunohistochemistry with validated antibodies

      • Western blotting for protein levels

      • qRT-PCR or RNA-seq for transcript levels

    • Correlate expression with disease progression or clinical parameters

  • Functional Studies in Disease Models:

    • Modulate ZNF256 expression in disease-relevant cell lines:

      • Overexpression to assess gain-of-function effects

      • siRNA/shRNA knockdown or CRISPR knockout for loss-of-function studies

    • Measure impact on disease-relevant phenotypes:

      • Proliferation, apoptosis, migration for cancer models

      • Differentiation capacity for developmental disorders

      • Specific disease biomarkers

  • Identification and Validation of Disease-Relevant Targets:

    • Perform ChIP-seq in disease models to identify differential binding

    • Integrate with transcriptomic data to identify dysregulated target genes

    • Validate key targets using reporter assays or targeted gene expression analysis

  • Genetic Association Studies:

    • Analyze potential genetic variants in ZNF256 or its binding sites

    • Assess correlation with disease risk or progression

    • Perform functional studies of disease-associated variants

  • Therapeutic Targeting:

    • Develop strategies to modulate ZNF256 activity:

      • Small molecule inhibitors of protein-protein interactions

      • Targeted degradation approaches

    • Assess effects of ZNF256 modulation on disease outcomes

This multifaceted approach provides comprehensive insights into ZNF256's potential roles in disease processes and identifies possible therapeutic interventions targeting this transcription factor or its regulatory networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.