ZNF384 Antibody

What is ZNF384 and what are its primary functions?

ZNF384 (also known as CIZ, NMP4, CAGH1, TNRC1) is a C2H2-type zinc finger protein that functions as a transcription factor. It binds to the consensus DNA sequence [GC]AAAAA and regulates the promoters of extracellular matrix genes including MMP1, MMP3, MMP7, and COL1A1 . The protein contains multiple zinc finger motifs that enable DNA binding, and it plays roles in gene regulation and transcription. Studies in mice suggest that nuclear matrix transcription factors like ZNF384/NMP4 may be involved in mechanical pathways that couple cell construction and function during extracellular matrix remodeling .

What are the molecular characteristics of ZNF384?

ZNF384 has a calculated molecular weight of 63 kDa but is typically observed at approximately 70 kDa in Western blot analyses . The protein contains long CAG trinucleotide repeats that encode consecutive glutamine residues . The human ZNF384 gene (ID: 171017) encodes a protein with a sequence containing multiple zinc finger domains. The immunogenic region commonly used for antibody production corresponds to amino acids 1-80 or 1-250 of human ZNF384 (NP_001129206.1), which includes the sequence: MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS .

What are the common applications for ZNF384 antibodies?

ZNF384 antibodies are primarily used in:

• Western blot (WB) analysis with recommended dilutions of 1:500-1:1000

• Immunohistochemistry on paraffin-embedded tissues (IHC-P) with recommended dilutions of 1:50-1:200

• ELISA applications

These antibodies show reactivity with human, mouse, and rat samples, making them versatile for comparative studies across species .

How should I optimize Western blot protocols for ZNF384 detection?

For optimal Western blot detection of ZNF384:

• Sample preparation: Use nuclear extracts as ZNF384 is primarily localized in the nucleus.

• Gel percentage: Use 8-10% SDS-PAGE gels for optimal separation.

• Transfer conditions: Transfer at 100V for 60-90 minutes using PVDF membrane.

• Blocking: Block with 5% non-fat milk in TBST for 1 hour at room temperature.

• Primary antibody incubation: Dilute ZNF384 antibody 1:500-1:1000 in blocking buffer and incubate overnight at 4°C.

• Expected band size: Look for a band at approximately 70 kDa (though calculated MW is 63 kDa).

• Positive controls: HeLa cells or rat thymus lysates have been confirmed as positive controls .

When analyzing results, note that post-translational modifications may cause the protein to run at a higher molecular weight than calculated.

What are the recommended protocols for immunohistochemical detection of ZNF384?

For IHC-P detection of ZNF384:

• Tissue preparation: Use 4% paraformaldehyde-fixed, paraffin-embedded sections (4-6 μm).

• Antigen retrieval: Perform high-pressure antigen retrieval with 10 mM citrate buffer (pH 6.0).

• Blocking: Block endogenous peroxidase activity with 3% H₂O₂, then block non-specific binding with 10% normal serum.

• Primary antibody: Dilute ZNF384 antibody 1:50-1:200 and incubate overnight at 4°C.

• Detection system: Use biotin-streptavidin-HRP detection system or polymer-based detection.

• Counterstaining: Counterstain with hematoxylin for nuclear visualization.

• Positive controls: Human tonsil, mouse lung, and rat testis have been validated for positive staining .

ZNF384 shows nuclear localization, so positive staining should be observed primarily in the nucleus.

How can I validate the specificity of ZNF384 antibodies?

To validate ZNF384 antibody specificity:

• Positive and negative controls:

  • Use tissues/cells known to express ZNF384 (HeLa cells, rat thymus)

  • Include tissues with low or no expression as negative controls

• Knockdown/knockout validation:

  • Generate ZNF384 knockdown (using shRNA) or knockout (using CRISPR/Cas9) cell lines as described in the literature

  • Compare antibody staining between wild-type and knockdown/knockout samples

• Peptide competition assay:

  • Pre-incubate the antibody with the immunizing peptide

  • Absence of signal confirms specificity

• Multiple antibody validation:

  • Test multiple antibodies targeting different epitopes of ZNF384

  • Consistent results across antibodies increase confidence in specificity

• Cross-reactivity assessment:

  • Test the antibody on samples from different species if working in non-human models

  • Verify sequence homology of the immunogen region across species

How is ZNF384 implicated in leukemia and what research approaches are recommended?

ZNF384 plays a significant role in lineage aberrant leukemia through its fusion oncoproteins (FO). Research approaches should include:

• Fusion partner identification:

  • ZNF384 can form fusions with multiple partners including EP300, EWSR1, TAF15, and TCF3 (E2A)

  • RT-PCR and immunoblotting are effective for validating fusion expression in patient samples

• Lineage ambiguity analysis:

  • ZNF384-rearranged leukemias show B-lymphoid/myeloid lineage ambiguity

  • Flow cytometry panels should include both B-cell markers and myeloid markers (CD13, CD33, MPO)

• Functional studies:

  • Viral expression of ZNF384 fusion oncoproteins in mouse and human hematopoietic stem and progenitor cells

  • Development of conditional expression models (e.g., Ep300::Znf384 knockin mouse models)

• Epigenetic profiling:

  • ChIP-seq for histone modifications (particularly H3K27ac)

  • Analysis of chromatin accessibility and ZNF384 occupancy

  • Integration of these approaches to understand downstream gene deregulation

ZNF384-rearranged leukemias are uniquely sensitive to FLT3 inhibition, suggesting a potential targeted therapy approach .

What is the role of ZNF384 in hepatocellular carcinoma and how can it be studied?

ZNF384 functions as a potential oncogene in hepatocellular carcinoma (HCC). Research approaches include:

How can I address common challenges in ZNF384 antibody-based experiments?

When interpreting results, consider that ZNF384 expression can vary significantly between tissues and disease states. Validation with multiple techniques is recommended.

How do I interpret ZNF384 expression patterns across different cell types and disease states?

Interpreting ZNF384 expression requires consideration of:

• Normal expression patterns:

  • ZNF384 is expressed at low levels in hematopoietic stem cells (HSCs)

  • Expression increases in subsequent developmental stages

  • Normal hematopoiesis appears unaffected in Znf384 knockout mice

• Leukemia expression patterns:

  • ZNF384 fusion oncoproteins (FO) show distinct localization and binding patterns

  • They occupy predominantly intragenic/enhancer regions with increased histone 3 lysine acetylation

  • Expression leads to deregulation of hematopoietic stem cell transcription factors

• HCC expression patterns:

  • Overexpression of ZNF384 in HCC tissues compared to adjacent normal tissues

  • Expression levels correlate with clinical outcomes and prognosis

• Quantification methodologies:

  • IHC: Score staining intensity (0-3) and percentage of positive cells

  • Western blot: Normalize to housekeeping proteins (β-actin, GAPDH) or nuclear markers (Lamin B)

  • qRT-PCR: Use validated reference genes and the ΔΔCt method

When comparing results across studies, consider differences in antibody clones, detection methods, and scoring systems.

How can ChIP-seq be optimized for studying ZNF384 binding sites and epigenetic regulation?

Optimizing ChIP-seq for ZNF384:

• Antibody selection:

  • Use ChIP-grade antibodies validated for immunoprecipitation

  • Verify specificity through Western blot before ChIP experiments

• Cross-linking optimization:

  • ZNF384 is a transcription factor, so standard 1% formaldehyde for 10 minutes works well

  • For studying interactions with other proteins, consider dual cross-linking with DSG followed by formaldehyde

• Sonication parameters:

  • Aim for fragments of 200-300 bp

  • Verify sonication efficiency by agarose gel electrophoresis

• Controls:

  • Input DNA (pre-immunoprecipitation)

  • IgG control (non-specific antibody)

  • Positive control (antibody against known abundant transcription factor)

• Data analysis pipeline:

  • Peak calling: MACS2 with q-value < 0.05

  • Motif analysis: HOMER, MEME

  • Integration with RNA-seq data

  • For fusion proteins, compare wild-type and fusion protein binding patterns

Research has shown that ZNF384 fusion oncoproteins occupy a subset of predominantly intragenic/enhancer regions with increased histone 3 lysine acetylation . There is also global enrichment of active enhancers within ZNF384 binding sites across the genome in ZNF384-rearranged ALL cells .

What approaches can be used to study ZNF384's role in enhancer-promoter interactions?

Advanced approaches to study ZNF384's role in enhancer-promoter interactions:

• Chromosome Conformation Capture (3C) technologies:

  • 4C-seq: Identify all genomic regions interacting with ZNF384-bound enhancers

  • Hi-C: Genome-wide analysis of chromatin interactions

  • HiChIP: Combine Hi-C with ChIP to identify ZNF384-mediated interactions

• CRISPR-based approaches:

  • CRISPR interference (CRISPRi): Target dCas9-KRAB to ZNF384 binding sites to suppress enhancer activity

  • CRISPR activation (CRISPRa): Target dCas9-VP64 to enhance ZNF384 binding sites

  • CRISPR screening of enhancer elements

• Reporter assays:

  • Luciferase reporter assays with enhancer elements

  • STARR-seq for high-throughput enhancer activity testing

• Epigenetic profiling:

  • ChIP-seq for histone modifications (H3K27ac, H3K4me1)

  • ATAC-seq for chromatin accessibility

  • Cut&Run or CUT&Tag for higher resolution factor binding

Research has identified an intergenic enhancer element at the FLT3 locus that is exclusively activated in ZNF384-rearranged ALL, with enhancer-promoter looping directly mediated by the fusion protein . This could serve as a model for studying other ZNF384-mediated enhancer-promoter interactions.

What are the advanced approaches for targeting ZNF384 in therapeutic development?

Advanced approaches for targeting ZNF384 in therapeutic development:

• Downstream pathway inhibition:

  • In ZNF384-rearranged ALL: FLT3 inhibitors (e.g., gilteritinib) show significant efficacy

    • Patient-derived xenograft models demonstrate anti-leukemia activity in vivo

    • Downregulation of ZNF384 blunts FLT3 activation and decreases ALL cell sensitivity to FLT3 inhibitors

  • In HCC: Target Cyclin D1 or cell cycle regulatory pathways activated by ZNF384

• Direct targeting strategies:

  • Proteolysis-targeting chimeras (PROTACs) to degrade ZNF384 protein

  • RNA interference: siRNA or shRNA delivery systems

  • Antisense oligonucleotides targeting ZNF384 mRNA

• Fusion-specific approaches:

  • Targeting the fusion junction with junction-specific antibodies

  • Developing fusion-selective degraders

  • Identifying synthetic lethal interactions specific to fusion-expressing cells

• Epigenetic modulators:

  • HDAC inhibitors may counteract histone acetylation patterns driven by ZNF384 fusions

  • BET inhibitors could disrupt enhancer-promoter interactions mediated by ZNF384

• Methodologies for validation:

  • Patient-derived xenograft (PDX) models of ZNF384-rearranged leukemia

  • CRISPR-engineered cell lines expressing ZNF384 fusions

  • High-throughput drug screening in ZNF384-driven cancer models

The discovery that ZNF384 fusion proteins drive epigenetic activation of FLT3 through enhancer-promoter looping provides a model for genomics-guided targeted therapy that could be applied to other ZNF384-driven cancers .

What are the critical technical specifications to consider when selecting a ZNF384 antibody?

When selecting between different antibodies, consider the specific epitope targeted and whether it may be affected by fusion events or post-translational modifications relevant to your research.

What are the recommended protocols for validating new research findings on ZNF384?

For validating new ZNF384 research findings:

• Expression validation:

  • Use at least two independent methods (e.g., WB, IHC, qRT-PCR)

  • Include appropriate positive and negative controls

  • Test multiple antibodies targeting different epitopes

• Functional validation:

  • Generate both knockdown and knockout models using different approaches (siRNA, shRNA, CRISPR/Cas9)

  • Perform rescue experiments by reintroducing ZNF384 or its mutants

  • Use multiple cell lines to ensure findings are not cell-type specific

• Mechanistic validation:

  • For transcriptional targets: Combine ChIP-seq with RNA-seq

  • For protein interactions: Use co-immunoprecipitation followed by mass spectrometry

  • For enhancer activity: Employ reporter assays and chromosome conformation capture techniques

• In vivo validation:

  • Utilize mouse models (conditional knockouts or knockins)

  • For cancer studies: Use patient-derived xenografts

  • Confirm findings in primary patient samples when available

• Data reproducibility:

  • Perform experiments with biological replicates (minimum n=3)

  • Use appropriate statistical analyses

  • Include effect sizes and confidence intervals