Acrp30 (108-244) Human
Description
Definition and Molecular Context
Acrp30 (108-244) Human is a truncated recombinant form of adiponectin, a 244-amino acid adipokine secreted by adipose tissue. This fragment corresponds to residues 108–244 of the full-length protein and includes the globular C1q domain critical for receptor binding and biological activity . Adiponectin, also termed ACRP30, AdipoQ, or GBP-28, regulates glucose homeostasis, lipid metabolism, and insulin sensitivity, with decreased circulating levels linked to obesity, insulin resistance, and type 2 diabetes . The recombinant fragment retains functional properties of the native protein and is widely used in experimental studies to dissect adiponectin signaling mechanisms .
Amino Acid Sequence
| Position | Sequence |
|---|---|
| 108–244 | MAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
Biological Functions
The globular domain of Acrp30 mediates key metabolic and anti-inflammatory effects:
-
Insulin Sensitivity: Enhances glucose uptake and fatty acid oxidation via AMP-activated protein kinase (AMPK) activation in skeletal muscle and liver .
-
Anti-Atherogenic Effects: Inhibits endothelial NF-κB signaling, reducing adhesion molecule expression and inflammation .
-
Anti-Cancer Activity: Induces apoptosis in breast cancer cells (e.g., MDA-MB-231) by suppressing Akt phosphorylation and cyclin D1 expression .
Key Functional Domains
| Domain | Residues | Role |
|---|---|---|
| Collagen-like | 1–107 | Trimerization and oligomerization |
| Globular | 108–244 | Receptor binding, AMPK activation |
Production and Physicochemical Properties
Acrp30 (108-244) is expressed in E. coli and purified via affinity chromatography .
Physical Properties
| Parameter | Specification |
|---|---|
| Molecular Weight | 18.1 kDa |
| Purity | >80% (SDS-PAGE) |
| Formulation | 20 mM Tris-HCl (pH 8.0), 10% glycerol, 0.4M urea |
| Stability | Store at -20°C; avoid freeze-thaw cycles |
Research Applications
-
In Vitro Studies: Used to investigate adiponectin’s role in glucose uptake, apoptosis, and inflammation .
-
Therapeutic Development: Explored for insulin-sensitizing and anti-atherogenic effects in preclinical models .
-
Biomarker Assays: Quantified via ELISA in serum/plasma to correlate levels with metabolic diseases .
Clinical Relevance
Low adiponectin levels are biomarkers for metabolic syndrome and cardiovascular risk . While full-length adiponectin replacement therapy is under study, Acrp30 (108-244) provides a tool to dissect domain-specific mechanisms. For example:
-
Obesity: Circulating adiponectin inversely correlates with body fat mass .
-
Diabetes: Improves insulin sensitivity in murine models via AMPK activation .
Limitations and Future Directions
Product Specs
Product Science Overview
Adiponectin is a protein hormone that plays a crucial role in regulating glucose levels and fatty acid breakdown. It is secreted by adipose tissue and has significant anti-diabetic, anti-atherogenic, and anti-inflammatory properties. The recombinant form of Adiponectin, specifically the fragment spanning amino acids 108-244, is often used in research to study its biological functions and therapeutic potential.
The recombinant human Adiponectin (108-244 a.a.) is a fragment of the full-length protein, which is typically expressed in Escherichia coli. This fragment includes the globular domain of Adiponectin, which is responsible for most of its biological activities. The recombinant protein is usually produced with high purity (>90%) and low endotoxin levels (<1 EU/µg), making it suitable for various biochemical assays and research applications .
Adiponectin is involved in several critical physiological processes:
- Metabolic Regulation: It enhances glucose utilization and fatty acid oxidation by activating AMP-activated protein kinase (AMPK) in the liver and skeletal muscle.
- Anti-inflammatory Effects: Adiponectin antagonizes the effects of tumor necrosis factor-alpha (TNF-α) by inhibiting its expression and activity in various tissues, including the liver and macrophages.
- Cardiovascular Protection: It inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway, which helps in reducing inflammation and atherosclerosis.
- Cell Growth and Angiogenesis: Adiponectin can bind and sequester various growth factors, influencing cell growth, angiogenesis, and tissue remodeling .
Reduced levels of Adiponectin are associated with obesity, insulin resistance, type 2 diabetes, and cardiovascular diseases. Therefore, understanding the mechanisms of Adiponectin and its therapeutic potential is of great interest in medical research. The recombinant form of Adiponectin (108-244 a.a.) is particularly valuable for studying these mechanisms and developing potential treatments for metabolic disorders .
