FGF 23 Human, His

Fibroblast Growth Factor-23 Human Recombinant, His Tag
Shipped with Ice Packs
In Stock

Description

Fibroblast Growth Factor-23 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His tag) and having a molecular mass of 28629.5 Dalton.
The FGF-23 is and purified by chromatographic techniques.

Product Specs

Introduction
Fibroblast growth factor-23 (FGF-23) belongs to the fibroblast growth factor (FGF) family, known for their roles in cell growth, survival, and various biological processes. FGF-23 specifically regulates phosphate metabolism by inhibiting renal tubular phosphate transport. Mutations in the FGF-23 gene are linked to phosphate wasting disorders like autosomal dominant hypophosphatemic rickets (ADHR) and oncogenic hypophosphatemic osteomalacia (OHO). Additionally, FGF23 mutations are implicated in familial tumoral calcinosis with hyperphosphatemia.
Description
Recombinant Human Fibroblast Growth Factor-23, expressed in E. coli, is a single, non-glycosylated polypeptide chain with a -6xHis tag. It consists of 257 amino acids (251 a.a. FGF23 + 6 a.a. His tag) and has a molecular weight of 28629.5 Daltons. The protein is purified using chromatographic techniques.
Physical Appearance
White, sterile-filtered lyophilized powder.
Formulation
The protein (0.5 mg/ml) was lyophilized from a solution of 25mM Tris pH 7.5 and 0.6M NaCl.
Solubility
To reconstitute the lyophilized Fibroblast Growth Factor-23, it is recommended to dissolve it in sterile 18 megaohm-cm H2O at a concentration of at least 100 micrograms/ml. Further dilutions can be made in other aqueous solutions.
Stability
Lyophilized Fibroblast Growth Factor 23 remains stable at room temperature for 3 weeks. However, it is recommended to store it desiccated at -18 degrees Celsius or below. After reconstitution, store FGF-23 at 4 degrees Celsius for up to 7 days. For long-term storage, freeze at -18 degrees Celsius or below after adding a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
Purity
Purity exceeds 90%, as determined by: (a) RP-HPLC analysis (b) SDS-PAGE analysis
Biological Activity
Human recombinant FGF23 has demonstrated biological activity by inducing FGFR-mediated Erk phosphorylation, reducing plasma PTH levels in rats, and decreasing blood phosphate levels.
Synonyms
Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23.
Source
Escherichia Coli.
Amino Acid Sequence
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARN
SYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFR
GNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPG
MNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRAR
MTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRP
FAKFIHHHHHH.

Product Science Overview

Introduction

Fibroblast Growth Factor-23 (FGF-23) is a member of the fibroblast growth factor (FGF) family, which is known for its broad mitogenic and cell survival activities. These factors are involved in various biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion . FGF-23 plays a crucial role in regulating phosphate metabolism and vitamin D metabolism in the body .

Structure and Production

The human recombinant FGF-23 (His Tag) is produced in Escherichia coli (E. coli) as a single, non-glycosylated polypeptide chain. It is expressed with a -6xHis tag, containing a total of 257 amino acids (251 amino acids of FGF-23 and 6 amino acids of the His tag), resulting in a molecular mass of approximately 28.6 kDa . The recombinant protein is purified using chromatographic techniques to ensure high purity and quality .

Biological Functions

FGF-23 is primarily involved in the regulation of phosphate homeostasis. It inhibits renal tubular phosphate transport, leading to decreased reabsorption of phosphate in the kidneys . This regulation is essential for maintaining proper phosphate levels in the blood and preventing disorders related to phosphate imbalance.

Clinical Significance

Mutations in the FGF23 gene have been associated with several disorders, including autosomal dominant hypophosphatemic rickets (ADHR) and familial tumoral calcinosis with hyperphosphatemia . Abnormally high levels of FGF-23 expression have also been observed in oncogenic hypophosphatemic osteomalacia (OHO), a disease characterized by abnormal phosphate metabolism .

Applications

The human recombinant FGF-23 (His Tag) is widely used in research to study its biological functions and potential therapeutic applications. It has been shown to induce FGFR-mediated Erk phosphorylation, reduce plasma parathyroid hormone (PTH) levels in rats, and lower blood phosphate levels . These properties make it a valuable tool for investigating phosphate metabolism and related disorders.

Storage and Stability

The lyophilized recombinant FGF-23 is stable at room temperature for up to three weeks but should be stored desiccated below -18°C for long-term storage . Upon reconstitution, it should be stored at 4°C for short-term use (2-7 days) and below -18°C for long-term use. To prevent freeze-thaw cycles, it is recommended to add a carrier protein such as 0.1% human serum albumin (HSA) or bovine serum albumin (BSA) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.