HBsAg preS2

Hepatitis B Surface Antigen, preS2 Recombinant
Shipped with Ice Packs
In Stock

Description

2.1. Hepatocyte Targeting

HBsAg preS2 interacts with the sodium taurocholate co-transporting polypeptide (NTCP), the primary HBV receptor. The myristoylated preS1/preS2 region facilitates viral entry via endocytosis .

2.2. Immune Modulation

  • Immunogenic Epitopes: PreS2 contains T- and B-cell epitopes, including residues 12–32 (B-cell) and 21–30 (T-cell) .

  • Immune Escape: Deletions in preS2 (e.g., Δ4–57) disrupt CD8+ T-cell recognition, enabling persistent infection and hepatocellular carcinoma (HCC) progression .

Clinical Implications of PreS2 Mutations

PreS2 mutations are strongly linked to HCC development, particularly in children and patients with advanced liver disease.

StudyFindingsSource
Pediatric HCCPreS2 deletions detected in 74% of HBV-associated HCC cases
HCC RiskPreS mutations increase HCC risk by 3.2x (HR = 3.210, 95% CI: 1.072–9.613)
ER StressPreS2ΔMT mutants cause ER retention, calcium overload, and mitochondrial dysfunction

Mechanisms:

  • Genomic Instability: PreS2 mutants disrupt DNA repair pathways (e.g., NBS1) and induce centrosome duplication, leading to aneuploidy .

  • Fibrosis: PreS2ΔMT mice show elevated liver fibrosis markers (e.g., α-SMA, collagen) .

4.1. Recombinant PreS2 Production

SystemMolecular WeightApplicationSource
E. coli5.7 kDaDiagnostic assays, vaccines
Pichia pastoris34 kDa (PreS2-S)Vaccine development
  • E. coli: Non-glycosylated preS2 (HBS-874) is purified for immunological studies .

  • Yeast: PreS2-S fusion proteins enhance vaccine immunogenicity by targeting hepatocytes .

4.2. Neutralization by Antibodies

AntibodyTargetNeutralization Mechanism
3E6 mAbpreS2 residues 18–22Blocks L/M protein-mediated entry
S26 mAbN-terminal preS2Prevents NTCP binding

Mutations in preS2 (e.g., Δ4–57) reduce antibody binding, enabling immune escape .

Research Gaps and Future Directions

  • Therapeutic Targets: Developing preS2-specific inhibitors to block NTCP interaction.

  • Biomarkers: Monitoring preS2 mutations in HCC surveillance.

  • Vaccine Design: Incorporating preS2 epitopes to enhance cross-protection against escape mutants .

Product Specs

Introduction
Hepatitis B virus (HBV) can cause serious liver disease in humans. The HBV surface protein antigens (HBsAg) consist of three carboxyl co-terminal HBs proteins: large (LHBs), middle (MHBs), and small (SHBs, also known as major). LHBs and MHBs share a highly hydrophobic, repetitive, membrane-spanning S domain. Additionally, MHBs has a 55 amino acid region called preS2.
Description
Recombinant Hepatitis B Surface Antigen preS2 is a single, non-glycosylated polypeptide chain consisting of 55 amino acids, with an approximate molecular weight of 5.7 kDa. It has been purified using a proprietary chromatographic technique.
Formulation
The HBsAg protein was lyophilized from a 0.2 µm filtered solution (1 mg/ml) in 20mM PB, at a pH of 7.4, with 50mM NaCl.
Solubility
Before opening, it is recommended to briefly centrifuge the vial to ensure the contents are at the bottom. Reconstitute the protein in sterile distilled water or an aqueous buffer containing 0.1% BSA to achieve a concentration of 0.1-1.0 mg/mL. Divide the stock solutions into smaller working aliquots and store them at temperatures below -20°C. Further dilutions should be prepared using appropriate buffered solutions.
Stability
The lyophilized product remains stable at temperatures between 2-8°C. However, for long-term storage, it is recommended to store it at -20°C, preferably in a desiccated environment. Once reconstituted, the preparation is stable for up to one week when stored at 2-8°C. To ensure maximum stability, divide the reconstituted preparation into working aliquots and store them at temperatures between -20°C and -70°C. Avoid repeated cycles of freezing and thawing.
Purity
Purity exceeds 95.0% as determined by: (a) Reverse-Phase High-Performance Liquid Chromatography (RP-HPLC) analysis. (b) Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis (SDS-PAGE) analysis.
Source
E.coli.
Amino Acid Sequence
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.

Q&A

What is the precise location and composition of the preS2 region in HBV?

The preS2 region is located on the surface of HBV mature virions and subviral particles (SVPs). It functions as a transcriptional transactivator and contains binding sites for several host proteins including fibronectin, transferrin, and polymerized human serum albumin (pHSA), which are associated with virus entry, release, and active replication . The preS2 region is part of the large surface protein (L-HBsAg) and middle surface protein (M-HBsAg), while the small surface protein (S-HBsAg) lacks this region. Structurally, the preS2 region spans approximately 55 amino acids that precede the S domain in both L and M surface proteins, with several conserved regions that serve various biological functions.

How do preS2 mutations affect HBV replication and virion production?

PreS2 mutations, particularly deletions, significantly impact HBV replication and virion production. The preS2Δ38-55 variant (deletion between nucleotides 38-55) has been identified as a major genetic variant associated with increased hepatocellular carcinoma (HCC) risk . These mutations alter the normal function of surface proteins, leading to retention in the endoplasmic reticulum, induction of ER stress, mitochondrial dysfunction, and cytokinesis failure . Mechanistically, preS2 mutants increase intracellular retention of surface proteins, which disrupts their normal trafficking and secretion. This retention causes accumulation of viral proteins inside hepatocytes, triggering cellular stress responses that contribute to genomic instability and eventually carcinogenesis.

What are the standard methods for detecting preS2 antigen in clinical samples?

Several methodologies exist for detecting preS2 antigen in clinical samples, ranging from traditional immunoassays to more advanced molecular techniques:

  • Immunochromatographic Assays (ICA): Rapid detection methods employ magnetic nanoparticles (MNPs) labeled with goat anti-mouse secondary antibodies as nanoprobes for preS2 antibody capturing. These assays can achieve a qualitative sensitivity of 625 ng/mL by naked-eye observation within 15-20 minutes and a quantitative limit of detection of 3.6 ng/mL using magnetic signal analysis .

  • Enzyme-Linked Immunosorbent Assays (ELISA): Commercial and research ELISAs using monoclonal antibodies specific to preS2 epitopes.

  • Western Blotting: For analyzing preS2-containing protein composition, particularly to distinguish between different forms of surface proteins (L, M, and S-HBsAg).

  • PCR-based methods: To detect preS2 gene mutations through amplification and sequencing of the relevant genomic regions.

The choice of method depends on the research question, required sensitivity, and available resources.

How do preS2 deletions specifically contribute to hepatocarcinogenesis at the molecular level?

The contribution of preS2 deletions to hepatocarcinogenesis involves multiple molecular mechanisms:

  • Endoplasmic Reticulum Stress: PreS2 mutant large surface antigen (PreS2-LHBS) shows higher ER retention compared to wild-type LHBS, inducing substantial ER stress . This stress leads to calcium accumulation and downstream effects including mitochondrial dysfunction.

  • Genomic Instability: PreS2-LHBS induces cytokinesis failure and subsequent chromosomal hyperploidy . The disruption of normal cell division processes leads to abnormal chromosomal content, a hallmark of cancer cells.

  • Immune Escape: The PreS2 deletion region corresponds to the epitope recognized by CD8 T cells, suggesting these mutations confer an immune-escape advantage . This allows infected hepatocytes to evade immune surveillance, permitting persistent infection and accumulation of oncogenic changes.

  • Transcriptional Dysregulation: PreS2 mutants can alter normal transcriptional patterns, affecting both viral and host gene expression.

  • Synergistic Effects: PreS2Δ38-55 variants demonstrate multiplicative joint effects with other risk factors, including HBeAg seropositivity (OR 43.1), high viral load (OR 22.7), low HBsAg levels (OR 19.0), and aflatoxin B1 exposure (OR 29.3) . These interactions significantly amplify HCC risk.

These mechanisms collectively create a cellular environment conducive to malignant transformation, explaining the strong association between preS2 mutations and HCC development.

What is the relationship between preS2 variants and HBsAg secretion efficiency?

The relationship between preS2 variants and HBsAg secretion is complex and significantly impacts viral pathogenesis:

  • Secretion Efficiency Differences: HBeAg-negative patients show lower serum HBsAg levels compared to HBeAg-positive patients, despite having similar intrahepatic HBsAg protein levels . This suggests impaired secretion rather than reduced production.

  • L-HBsAg Proportion: Increased proportion of preS1 mRNA derived from integrated HBV DNA results in higher L-HBsAg proportion and impaired HBsAg secretion . L-HBsAg contains the preS1 and preS2 domains, and its overexpression relative to other surface proteins disrupts the normal secretion process.

  • Transcriptional Regulation: Enhancer 1 (EnhI) in integrated HBV DNA can retarget preS1 (SP1) and preS2 (SP2) promoters, disrupting their transcriptional activity balance . This alters the relative production of different surface proteins, affecting their assembly and secretion.

  • Quantitative Evidence: In experimental models, HBsAg secretion efficiency is approximately 40% lower in cells transfected with integrated HBV DNA mimics compared to those with covalently closed circular DNA (cccDNA) .

  • PreS2 Mutations: Specific mutations in the preS2 region, particularly deletions, can further impair the normal trafficking and secretion of surface proteins, contributing to their intracellular accumulation.

These findings suggest that preS2 variants influence HBsAg secretion through multiple mechanisms, with important implications for viral persistence, immune recognition, and disease progression.

How reliable are preS2 mutations as biomarkers for HCC risk stratification in chronic HBV patients?

The reliability of preS2 mutations as biomarkers for HCC risk stratification is supported by several lines of evidence:

  • Strong Statistical Association: PreS2Δ38-55 variants have been identified as independent risk factors for HCC in multivariable analysis, with significant odds ratios . This statistical strength supports their potential utility as biomarkers.

  • Prevalence in HCC: PreS2 mutants are prevalent in over 50% of patients with HCC , indicating high sensitivity for identifying at-risk populations.

  • Mechanistic Plausibility: The oncogenic mechanisms of preS2 mutants are well-characterized, providing biological plausibility for their role as biomarkers. Transgenic mice expressing PreS2-LHBS develop liver dysplasia and HCC, providing in vivo validation .

  • Synergistic Effects: The multiplicative joint effect of preS2Δ38-55 variants with other established risk factors enhances their predictive value. When combined with other markers (HBeAg status, viral load, HBsAg levels), they provide more comprehensive risk assessment .

  • Limitations and Considerations:

    • Detection methods vary in sensitivity and specificity

    • Geographical and genotype variations may influence prevalence

    • Temporal dynamics of mutation acquisition during chronic infection

    • Need for standardization of detection protocols

For optimal clinical utility, preS2 mutation analysis should be integrated with other established risk factors in a comprehensive risk stratification algorithm for chronic HBV patients.

What are the optimal experimental models for studying preS2 variants and their oncogenic effects?

Several experimental models have demonstrated utility for studying preS2 variants, each with distinct advantages:

  • Cell Culture Systems:

    • HepG2-NTCP cells: Human hepatoma cells expressing the HBV receptor NTCP, allowing for infection studies with wild-type and mutant viruses .

    • PLC/PRF/5: Human hepatoma cell line containing natural HBV integrations, useful for studying integrated HBV DNA functions .

    • HepG2 cells transfected with plasmids mimicking cccDNA (prcccDNA) or integrated HBV DNA (p-dslDNA): For comparative studies of HBsAg production and secretion from different viral DNA templates .

  • Animal Models:

    • Transgenic mice expressing PreS2-LHBS: These models develop liver dysplasia and HCC, recapitulating the oncogenic process observed in humans .

    • Humanized liver chimeric mice: Allow for study of HBV infection in the context of human hepatocytes in vivo.

  • Reporter Systems:

    • HBV-HiBiT-PS2: A novel HBV reporter system constructed by adding an HiBiT-tag at the 5' end of preS2, facilitating monitoring of most of the replication cycle of HBV and evaluation of inhibitor effects .

    • Stability reporter platforms: Used for screening compounds that affect preS2-LHBS stability .

  • Human Samples:

    • Liver biopsies from chronically infected patients at different disease stages.

    • Serial serum samples for longitudinal studies of preS2 variant emergence.

The choice of model should be guided by the specific research question, with consideration of the advantages and limitations of each system. Multi-model approaches are often most informative, combining in vitro mechanistic studies with in vivo validation.

What techniques are most effective for detecting and quantifying preS2 mutants in clinical samples?

Effective detection and quantification of preS2 mutants requires a combination of techniques:

  • Nucleic Acid-Based Methods:

    • Next-Generation Sequencing (NGS): Provides comprehensive detection of all variants, including minor populations, with quantitative assessment of variant frequencies.

    • Long-read RNA sequencing: Particularly useful for analyzing the transcriptional landscape of preS genes, as used in studies of liver tissues from patients with chronic HBV infection .

    • PCR-based approaches:

      • Mutation-specific PCR: For targeted detection of known deletions.

      • Restriction fragment length polymorphism (RFLP): For screening known mutation patterns.

      • Digital PCR: For absolute quantification of specific variants.

  • Protein-Based Methods:

    • Western blotting: For analyzing HBsAg composition, particularly to detect altered migration patterns of mutant surface proteins .

    • Immunohistochemistry (IHC): For visualizing intrahepatic HBsAg distribution and quantifying levels in tissue samples .

    • Mass spectrometry: For detailed proteomic analysis of preS2 variants.

  • Combination Approaches:

    • Correlation of serum HBsAg levels with intrahepatic HBsAg IHC scores to assess secretion efficiency .

    • Northern blotting combined with Western blotting to relate RNA transcript patterns to protein production .

Table 1: Comparison of Methods for PreS2 Mutant Detection

MethodSensitivitySpecificityQuantitativeSample TypeAdvantagesLimitations
NGSVery HighHighYesSerum, TissueComprehensive variant detectionCost, bioinformatics expertise required
Long-read RNA seqHighHighYesTissue RNAFull-length transcript analysisRequires fresh/frozen tissue
Mutation-specific PCRHighVery HighLimitedSerum, TissueSimple, targetedOnly detects known mutations
Western blottingModerateHighSemiTissue, Cell lysateDirect protein analysisLimited quantification
IHCModerateModerateSemiFixed tissueSpatial informationSubjective scoring
Mass spectrometryHighVery HighYesPurified proteinDetailed structural analysisComplex sample preparation

The optimal approach often involves combining multiple techniques to provide comprehensive characterization of preS2 variants.

How can researchers develop reporter systems for studying preS2 function in viral replication?

Development of effective reporter systems for studying preS2 function requires careful consideration of design elements:

  • Strategic Tag Placement:

    • The HBV-HiBiT-PS2 reporter system demonstrates successful integration of a reporter tag (HiBiT) at the 5' end of preS2 . This positioning maintains viral protein functionality while enabling sensitive detection.

    • Selection of tag size and properties is critical - smaller tags like HiBiT (11 amino acids) minimize disruption of protein structure and function.

  • Cell Line Selection:

    • Reporter systems should be introduced into relevant cell lines such as HepG2-NTCP that support the complete HBV replication cycle .

    • Validation across multiple cell lines enhances robustness of findings.

  • Validation Approaches:

    • Characterization of reporter virion components through sucrose density gradient ultracentrifugation confirms proper assembly .

    • Replication kinetics analysis comparing wild-type and reporter-tagged viruses ensures the reporter does not disrupt viral life cycle.

    • Testing with known HBV inhibitors validates the system's utility for drug screening .

  • Specialized Applications:

    • Reporter systems can be designed for specific aspects of preS2 function:

      • Secretion monitoring: The HBV-HiBiT-PS2 system is particularly useful for screening HBsAg secretion inhibitors as most HiBiT activity derives from subviral particles .

      • Stability assessment: Reporter platforms for screening compounds affecting preS2-LHBS stability .

      • Transcriptional activity: Systems incorporating luminescent or fluorescent reporters downstream of preS2 promoters.

These reporter systems provide powerful tools for understanding preS2 function and screening potential therapeutic compounds targeting this region.

What strategies are being explored to target preS2 mutants for HCC prevention?

Multiple therapeutic strategies targeting preS2 mutants are under investigation:

  • Chemical-Induced Degradation:

    • ABT199 has been identified as an inhibitor of PreS2-LHBS from a library of FDA-approved drugs, inducing its degradation without affecting general cell viability .

    • The mechanism involves triggering microautophagy of PreS2-LHBS, providing a selective approach to eliminate this oncogenic protein .

    • Long-term treatment with ABT199 significantly reversed PreS2-LHBS-induced oncogenic events including DNA damage, mitotic failure, chromosome hyperploidy, and anchorage-independent growth .

  • Blocking PreS2 Functions:

    • Inhibitors targeting the binding of preS2 to host factors like fibronectin, transferrin, and polymerized human serum albumin (pHSA) .

    • Peptides or small molecules disrupting preS2's transcriptional transactivator function.

  • Immune-Based Approaches:

    • Therapeutic vaccines targeting preS2 epitopes to enhance immune clearance of infected cells.

    • Note: Immunization studies have shown that native preS2 sequence or unconjugated synthetic peptides do not elicit anti-HSA (human serum albumin) antibodies, suggesting selective targeting is possible .

  • HBsAg Secretion Inhibition:

    • Compounds that normalize the balance of surface protein production or enhance secretion may reduce intracellular accumulation of preS2 mutants.

    • The HBV-HiBiT-PS2 reporter system provides a platform for screening such inhibitors .

  • Transcriptional Regulation:

    • Approaches targeting the dysregulated activity of Enhancer 1 (EnhI) on preS1 and preS2 promoters in integrated HBV DNA .

    • Modulation of epigenetic factors controlling preS2 expression.

Long-term strategies must consider both the efficacy in eliminating preS2 mutant proteins and the potential to reverse existing oncogenic cellular changes. Combination approaches may be necessary for comprehensive prevention of HBV-related HCC.

How can researchers design effective screening assays for preS2-targeting drug candidates?

Designing effective screening assays for preS2-targeting drug candidates requires:

  • Reporter System Design:

    • The HBV-HiBiT-PS2 reporter system represents an excellent platform, constructed by adding an HiBiT-tag at the 5' end of preS2 .

    • This system allows monitoring of most of the HBV replication cycle and evaluation of inhibitor effects through quantifiable HiBiT activity .

    • For PreS2-LHBS degradation screening, stability reporter platforms can identify compounds that reduce protein levels without affecting general cell viability .

  • Cell-Based Screening Approaches:

    • Primary assay parameters:

      • HBsAg secretion inhibition

      • PreS2-LHBS degradation

      • Reversal of preS2-induced cellular phenotypes

    • Secondary validation assays:

      • Effects on viral replication markers

      • Specificity testing against related viral proteins

      • Cytotoxicity evaluation

      • Mechanism of action studies

  • Methodological Considerations:

    • Assay miniaturization for high-throughput screening

    • Use of appropriate controls:

      • Known HBV inhibitors as positive controls

      • Vehicle controls

      • Off-target controls

    • Data normalization and quality control metrics

    • Dose-response testing for promising hits

  • Specialized Screening Applications:

    • For secretion inhibitors: The HBV-HiBiT-PS2 system is particularly effective as most HiBiT activity derives from subviral particles (HBsAg multimers) .

    • For degradation inducers: Assays monitoring PreS2-LHBS protein levels after compound treatment .

    • For functional inhibitors: Assays evaluating disruption of specific preS2 interactions with host factors.

These approaches provide a systematic pathway for identifying and characterizing compounds with therapeutic potential against preS2-related pathogenesis.

What are the immunological considerations when targeting preS2 for therapeutic interventions?

Important immunological considerations for preS2-targeted therapeutics include:

These immunological considerations are critical for developing safe and effective preS2-targeted therapeutic interventions that avoid unintended autoimmune consequences while maximizing antiviral efficacy.

How do preS2 mutations correlate with treatment outcomes and disease progression across different HBV genotypes?

The correlation between preS2 mutations and clinical outcomes shows important genotype-specific patterns:

  • Genotype Variations:

    • Genotype A has been specifically associated with HCC development in conjunction with preS2Δ38-55 variants, as identified in multivariable analysis . This suggests genotype-specific interactions with preS2 mutations.

    • Different HBV genotypes show varying frequencies of preS2 mutations, which may partly explain regional differences in HCC incidence.

  • Treatment Response Correlations:

    • HBsAg composition patterns can predict treatment response in chronic HBV infection . The amount and proportions of HBsAg components, including preS2-containing proteins, serve as useful markers.

    • In HBeAg-negative patients, who typically show lower serum HBsAg levels but similar intrahepatic HBsAg protein levels compared to HBeAg-positive patients , treatment responses may differ due to altered viral antigen presentation to the immune system.

  • Disease Progression Markers:

    • Lower HBsAg secretion efficiency, often associated with preS2 variants, correlates with disease phase. This is evidenced by the finding that HBeAg-negative patients demonstrate impaired HBsAg secretion due to increased L-HBsAg proportion .

    • The multiplicative joint effects of preS2Δ38-55 variants with other risk factors (HBeAg status, viral load, HBsAg levels, aflatoxin exposure) create distinct risk profiles that can inform monitoring and intervention strategies .

  • Integrated vs. Episomal HBV DNA:

    • In advanced disease stages, HBsAg increasingly originates from integrated HBV DNA rather than cccDNA, particularly in HBeAg-negative patients . This shift affects the balance of surface proteins produced and may influence both disease progression and treatment response.

  • Research Implications:

    • Genotype-specific treatment algorithms may be necessary to address the varying impacts of preS2 mutations.

    • Longitudinal studies examining preS2 variant evolution during treatment are needed to fully understand their predictive value.

    • Combination biomarkers incorporating preS2 mutation status with other viral and host factors may provide more comprehensive prognostic information.

These correlations highlight the importance of considering both viral genotype and preS2 mutation status in personalized management of chronic HBV infection.

What are the best approaches for integrating preS2 mutation analysis into clinical risk assessment algorithms?

Integrating preS2 mutation analysis into clinical risk assessment requires a systematic approach:

  • Sampling Strategy:

    • Sequential sampling during disease course to capture evolutionary dynamics of preS2 variants.

    • Consideration of both serum and liver tissue when available, as intrahepatic and circulating viral populations may differ.

    • Standardized protocols for sample collection, storage, and processing to ensure reproducibility.

  • Testing Methodology Standardization:

    • Development of validated, standardized assays for preS2 mutation detection with defined sensitivity, specificity, and reproducibility.

    • Potential testing algorithms:

      • Initial screening with cost-effective methods (PCR-based)

      • Confirmation and detailed characterization with more sensitive techniques (NGS)

      • Quantitative assessment of mutation frequency within the viral population

  • Risk Stratification Models:

    • Multivariable models incorporating:

      • PreS2 mutation status (particularly preS2Δ38-55)

      • HBV genotype (especially Genotype A)

      • Viral markers (HBeAg status, viral load, HBsAg levels)

      • Host factors (age, gender, liver function)

      • Environmental exposures (such as aflatoxin B1)

    • Weighting factors based on the multiplicative joint effects observed in epidemiological studies

  • Risk Assessment Tool Development:

    • Clinical decision support tools integrating all relevant factors

    • Mobile applications or web-based calculators for point-of-care risk assessment

    • Automated systems integrated with electronic health records

  • Implementation Considerations:

    • Cost-effectiveness analysis to determine optimal testing strategies

    • Tiered testing approaches based on initial risk assessment

    • Education of healthcare providers on interpretation and clinical application

    • Regular updating of algorithms as new data emerge

  • Validation Requirements:

    • Prospective cohort studies to validate predictive performance

    • Assessment across diverse populations and healthcare settings

    • Comparison with existing risk assessment tools

    • Evaluation of impact on clinical outcomes when implemented

This integrated approach would maximize the clinical utility of preS2 mutation analysis while ensuring cost-effective application in diverse healthcare settings.

What emerging technologies might enhance our understanding of preS2 variants in HBV pathogenesis?

Several cutting-edge technologies show promise for advancing preS2 research:

  • Single-Cell Genomics and Transcriptomics:

    • Single-cell RNA sequencing to reveal cell-specific responses to preS2 variants

    • Spatial transcriptomics to map preS2 variant distribution and effects across liver tissue

    • Integration with cell lineage tracing to understand clonal expansion of cells harboring specific preS2 mutations

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize preS2 protein trafficking and interactions at nanoscale resolution

    • Live-cell imaging with fluorescently tagged preS2 variants to track real-time dynamics

    • Correlative light and electron microscopy to link preS2 localization with ultrastructural changes

  • Structural Biology Approaches:

    • Cryo-electron microscopy to determine high-resolution structures of wild-type and mutant preS2 domains

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes induced by mutations

    • In silico molecular dynamics simulations to predict functional impacts of specific mutations

  • CRISPR-Based Technologies:

    • Base editing or prime editing for precise introduction of specific preS2 mutations

    • CRISPR interference/activation systems to modulate preS2 expression

    • CRISPR screens to identify host factors interacting with preS2 variants

  • Proteomics and Interactomics:

    • Proximity labeling techniques to map the protein interaction network of wild-type vs. mutant preS2

    • Quantitative proteomics to assess global cellular changes induced by preS2 variants

    • Phosphoproteomics to identify signaling pathways altered by preS2 mutations

  • Organoid and Advanced 3D Culture Systems:

    • Liver organoids from patients with different preS2 variants

    • Microfluidic liver-on-a-chip systems to model preS2 variant effects in physiologically relevant conditions

    • Co-culture systems incorporating immune components to study preS2-immune interactions

These technologies, particularly when used in combination, have the potential to provide unprecedented insights into preS2 biology and pathogenesis, potentially revealing new therapeutic targets.

What are the key remaining knowledge gaps in preS2 biology that researchers should prioritize?

Several critical knowledge gaps in preS2 biology warrant focused research attention:

  • Structural-Functional Relationships:

    • Detailed mapping of how specific amino acid residues in preS2 contribute to different functions

    • Structural consequences of common preS2 mutations, particularly the preS2Δ38-55 deletion

    • Conformational changes in preS2 during different stages of the viral life cycle

  • Host Interaction Networks:

    • Comprehensive identification of all host factors interacting with preS2

    • Differential interactions between wild-type and mutant preS2 proteins

    • Temporal dynamics of these interactions during infection

  • Evolutionary Dynamics:

    • Factors driving the emergence and selection of preS2 variants during chronic infection

    • Relationship between host immune pressure and preS2 mutation patterns

    • Transmission dynamics of preS2 variants between individuals

  • Mechanistic Details of Oncogenesis:

    • Complete signaling pathways linking preS2 mutations to cellular transformation

    • Epigenetic changes induced by preS2 variants

    • Interactions with host oncogenes and tumor suppressors

  • Immune Evasion Strategies:

    • Mechanisms by which preS2 mutations confer immune escape advantages

    • Impact on both innate and adaptive immune responses

    • Potential for immune restoration by targeting preS2 variants

  • Therapeutic Resistance:

    • Role of preS2 variants in resistance to current and emerging therapies

    • Predictive markers of treatment response based on preS2 status

    • Strategies to overcome resistance mechanisms

  • Population-Level Impacts:

    • Geographical distribution and prevalence of specific preS2 variants

    • Association with disease burden across different populations

    • Public health implications for screening and prevention strategies

Addressing these knowledge gaps will require collaborative, multidisciplinary approaches and may yield critical insights for developing more effective therapeutic and preventive strategies against HBV-related liver disease.

Product Science Overview

Introduction

Hepatitis B is a significant global health concern, caused by the Hepatitis B virus (HBV). The virus can lead to both acute and chronic liver diseases, including cirrhosis and hepatocellular carcinoma. The Hepatitis B Surface Antigen (HBsAg) is a key component of the virus and plays a crucial role in the development of vaccines and diagnostic tests. Among the various forms of HBsAg, the preS2 recombinant antigen has garnered attention for its potential to enhance immune responses.

Structure and Function

The Hepatitis B virus envelope contains three surface proteins: large (L), middle (M), and small (S) proteins. These proteins are encoded by the same gene but differ in their N-terminal extensions. The preS2 region is part of the middle (M) protein and is located between the preS1 and S regions. The preS2 region is known for its immunogenic properties, making it a valuable target for vaccine development.

Recombinant Technology

Recombinant DNA technology has enabled the production of the preS2 antigen in various host systems, such as yeast and mammalian cells. This technology involves inserting the gene encoding the preS2 region into a suitable expression vector, which is then introduced into the host cells. The host cells produce the preS2 protein, which can be purified and used for various applications, including vaccine development and diagnostic assays.

Immunogenicity and Vaccine Development

The preS2 region has been shown to enhance the immunogenicity of HBsAg. Studies have demonstrated that vaccines containing the preS2 antigen can induce stronger and more durable immune responses compared to vaccines containing only the S antigen. The inclusion of the preS2 region in hepatitis B vaccines has been explored to improve the efficacy of vaccination, particularly in individuals who do not respond adequately to conventional vaccines .

Clinical Applications

Recombinant preS2 antigens are used in the development of advanced hepatitis B vaccines. These vaccines aim to provide better protection by eliciting a broader immune response. Additionally, the preS2 antigen is utilized in diagnostic assays to detect HBV infections. The presence of antibodies against the preS2 region can indicate exposure to the virus and help in the diagnosis of hepatitis B.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.